KEGG   Homo sapiens (human): 6909Help
Entry
6909              CDS       T01001                                 

Gene name
TBX2, VETD
Definition
(RefSeq) T-box transcription factor 2
  KO
K10176  T-box protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6909 (TBX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    6909 (TBX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box TBX
Motif
Other DBs
NCBI-GeneID: 6909
NCBI-ProteinID: NP_005985
OMIM: 600747
HGNC: 11597
Ensembl: ENSG00000121068
Vega: OTTHUMG00000156986
Pharos: Q13207(Tbio)
UniProt: Q13207 A0A024QZ86
LinkDB All DBs
Position
17q23.2
AA seq 712 aa AA seqDB search
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGA
AAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK
LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADP
EMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN
DILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRARAEEKSCAADS
DPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
GPLGAGQPLFLHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPA
ASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLP
ELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagagagccggcgctggcggccagcgccatggcttaccacccgttccacgcgccacgg
cccgccgacttccccatgtccgcctttctggcggcggcgcagccctccttcttcccggca
ctcgcgctgccgcccggcgcgctggccaagccgctgcccgacccgggcctggcgggggcg
gcggccgcggcggcggcggcggcagcagcggccgaggcggggctgcacgtctcggcactg
ggcccgcacccgcccgccgcgcatctgcgctccctcaagagcctggagcccgaggacgag
gtggaggacgaccccaaggtgacgctggaggccaaggagctgtgggaccagttccacaag
ctaggcacggagatggtcatcaccaagtccgggaggcggatgttcccccccttcaaggtg
cgagtcagcggcctggacaagaaggccaagtatatcctgctgatggacattgtagccgct
gacgattgccgctataagttccacaactcgcgctggatggtggcgggcaaggccgaccct
gagatgcccaaacgcatgtacatccacccagacagcccagccacgggggagcagtggatg
gctaagcctgtggccttccacaagctgaagctgaccaacaacatctctgacaagcacggc
ttcaccatcctaaactccatgcacaagtaccagccgcgcttccacatagtgcgagccaac
gacatcctgaagctgccttacagcaccttccgcacctacgtgttcccggagaccgacttc
atcgccgtcactgcctaccagaatgacaagatcacacagctgaagatcgacaacaacccg
tttgccaagggcttccgggacaccgggaacggccggcgggagaaaaggaagcagctgacg
ctgccgtctctacgcttgtacgaggagcactgcaaacccgagcgcgatggcgcggagtca
gacgcctcgtcgtgcgaccctccccccgcgcgggaaccacccacctccccgggcgcagcg
cccagtccgctgcgcctgcaccgggcccgagctgaggagaagtcgtgcgccgcggacagc
gacccggagcctgagcggttgagcgaggagcgtgcgggggcgccgctaggccgcagcccg
gctccagacagcgccagccccactcgcttgaccgaacccgagcgcgcccgggagcggcgt
agtcccgagaggggcaaggagccggccgagagcggcggggacggcccgttcggcctgagg
agcctggagaaggagcgcgccgaagctcggaggaaggacgaggggcgcaaggaggcggcc
gagggcaaggagcagggcctggcgccgctggtggtgcagacagacagtgcgtcccccctg
ggcgccggacacctgcccggcctggccttttccagccacttgcacgggcagcagttcttt
gggccgctgggagccggccagccgctcttcctgcaccctggacagttcaccatgggccct
ggcgccttctccgccatgggcatgggtcacctactggcctcggtggcaggcggcggcaac
ggcggaggtggcgggcctgggaccgccgcggggctggacgcaggcgggctgggtcccgcg
gccagcgcagcaagcaccgccgcgcccttcccgttccacctctcccagcacatgctggca
tctcagggaattccaatgcccactttcggaggcctcttcccctacccctacacctacatg
gcagcagcagccgcagccgcctcggctttgcccgccactagtgctgcagctgccgccgcc
gcagccgccggctccctctcccggagccccttcctgggcagtgcccggccccgactgcgt
ttcagcccctatcagatcccggtcaccatcccgcctagcactagcctcctcaccaccggg
ctggcctctgagggctccaaggccgctggtggaaacagccgggagcctagccccctgccc
gagctggctctccgcaaagtaggggccccatcccgcggtgccctgtcgcccagtggctcg
gccaaggaggcggccaatgaactgcagagcatccagagactggtgagtgggctggagagc
cagcgagccctctccccaggccgggagtcgcccaagtga

DBGET integrated database retrieval system