KEGG   Homo sapiens (human): 6915Help
Entry
6915              CDS       T01001                                 

Gene name
TBXA2R, BDPLT13, TXA2-R
Definition
(RefSeq) thromboxane A2 receptor
  KO
K04264  thromboxane A2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04611  Platelet activation
Disease
H01235  Bleeding disorder platelet-type
Drug target
Cilostazol: D01896
Daltroban: D03642
Domitroban calcium hydrate: D09824
Ifetroban (DG01350): D04500 D04501
Imitrodast sodium: D09774
Picotamide: D07140
Ramatroban: D01128
Ridogrel: D05727
Seratrodast: D01123
Sulotroban: D05970
Terbogrel: D06077
Vapiprost hydrochloride: D06280
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    6915 (TBXA2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6915 (TBXA2R)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6915 (TBXA2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6915 (TBXA2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Thromboxane
    6915 (TBXA2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF3784 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 6915
NCBI-ProteinID: NP_001051
OMIM: 188070
HGNC: 11608
Ensembl: ENSG00000006638
Vega: OTTHUMG00000180806
Pharos: P21731(Tclin)
UniProt: P21731 Q05C92 Q0VAB0
LinkDB All DBs
Position
19p13.3
AA seq 343 aa AA seqDB search
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccaacggcagttccctggggccctgtttccggcccacaaacattaccctggag
gagagacggctgatcgcctcgccctggttcgccgcctccttctgcgtggtgggcctggcc
tccaacctgctggccctgagcgtgctggcgggcgcgcggcaggggggttcgcacacgcgc
tcctccttcctcaccttcctctgcggcctcgtcctcaccgacttcctggggctgctggtg
accggtaccatcgtggtgtcccagcacgccgcgctcttcgagtggcacgccgtggaccct
ggctgccgtctctgtcgcttcatgggcgtcgtcatgatcttcttcggcctgtccccgctg
ctgctgggggccgccatggcctcagagcgctacctgggtatcacccggcccttctcgcgc
ccggcggtcgcctcgcagcgccgcgcctgggccaccgtggggctggtgtgggcggccgcg
ctggcgctgggcctgctgcccctgctgggcgtgggtcgctacaccgtgcaatacccgggg
tcctggtgcttcctgacgctgggcgccgagtccggggacgtggccttcgggctgctcttc
tccatgctgggcggcctctcggtcgggctgtccttcctgctgaacacggtcagcgtggcc
accctgtgccacgtctaccacgggcaggaggcggcccagcagcgtccccgggactccgag
gtggagatgatggctcagctcctggggatcatggtggtggccagcgtgtgttggctgccc
cttctggtcttcatcgcccagacagtgctgcgaaacccgcctgccatgagccccgccggg
cagctgtcccgcaccacggagaaggagctgctcatctacttgcgcgtggccacctggaac
cagatcctggacccctgggtgtatatcctgttccgccgcgccgtgctccggcgtctccag
cctcgcctcagcacccggcccaggtcgctgtccctccagccccagctcacgcagcgctcc
gggctgcagtag

DBGET integrated database retrieval system