KEGG   Homo sapiens (human): 6929Help
Entry
6929              CDS       T01001                                 

Gene name
TCF3, AGM8, E2A, E47, ITF1, TCF-3, VDIR, bHLHb21, p75
Definition
(RefSeq) transcription factor 3
  KO
K09063  transcription factor E2-alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06240  Transcription
  Element
N00117  E2A-PBX1 fusion to transcriptional activation
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
N00511  HTLV-1 Tax to E47-mediated transcription
Disease
H00001  B-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6929 (TCF3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6929 (TCF3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6929 (TCF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6929 (TCF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Ubiquitous (class A) factors
    6929 (TCF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH CDC45
Motif
Other DBs
NCBI-GeneID: 6929
NCBI-ProteinID: NP_003191
OMIM: 147141
HGNC: 11633
Ensembl: ENSG00000071564
Vega: OTTHUMG00000180031
Pharos: P15923(Tbio)
UniProt: P15923
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 654 aa AA seqDB search
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWG
SGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGL
TQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPML
GGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGAT
YGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSP
QGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPD
SYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPP
EQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVIL
NLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccgcagaggatggcgcctgtgggcacagacaaggagctcagtgacctcctg
gacttcagcatgatgttcccgctgcctgtcaccaacgggaagggccggcccgcctccctg
gccggggcgcagttcggaggttcaggtcttgaggaccggcccagctcaggctcctggggc
agcggcgaccagagcagctcctcctttgaccccagccggaccttcagcgagggcacccac
ttcactgagtcgcacagcagcctctcttcatccacattcctgggaccgggactcggaggc
aagagcggtgagcggggcgcctatgcctccttcgggagagacgcaggcgtgggcggcctg
actcaggctggcttcctgtcaggcgagctggccctcaacagccccgggcccctgtcccct
tcgggcatgaaggggacctcccagtactacccctcctactccggcagctcccggcggaga
gcggcagacggcagcctagacacgcagcccaagaaggtccggaaggtcccgccgggtctt
ccatcctcggtgtacccacccagctcaggtgaggactacggcagggatgccaccgcctac
ccgtccgccaagacccccagcagcacctatcccgcccccttctacgtggcagatggcagc
ctgcacccctcagccgagctctggagtcccccgggccaggcgggcttcgggcccatgctg
ggtgggggctcatccccgctgcccctcccgcccggtagcggcccggtgggcagcagtgga
agcagcagcacgtttggtggcctgcaccagcacgagcgtatgggctaccagctgcatgga
gcagaggtgaacggtgggctcccatctgcatcctccttctcctcagcccccggagccacg
tacggcggcgtctccagccacacgccgcctgtcagcggggccgacagcctcctgggctcc
cgagggaccacagctggcagctccggggatgccctcggcaaagcactggcctcgatctac
tccccggatcactcaagcaataacttctcgtccagcccttctacccccgtgggctccccc
cagggcctggcaggaacgtcacagtggcctcgagcaggagcccccggtgccttatcgccc
agctacgacgggggtctccacggcctgcagagtaagatagaagaccacctggacgaggcc
atccacgtgctccgcagccacgccgtgggcacagccggcgacatgcacacgctgctgcct
ggccacggggcgctggcctcaggtttcaccggccccatgtcactgggcgggcggcacgca
ggcctggttggaggcagccaccccgaggacggcctcgcaggcagcaccagcctcatgcac
aaccacgcggccctccccagccagccaggcaccctccctgacctgtctcggcctcccgac
tcctacagtgggctagggcgagcaggtgccacggcggccgccagcgagatcaagcgggag
gagaaggaggacgaggagaacacgtcagcggctgaccactcggaggaggagaagaaggag
ctgaaggccccccgggcccggaccagcccagacgaggacgaggacgaccttctcccccca
gagcagaaggccgagcgggagaaggagcgccgggtggccaataacgcccgggagcggctg
cgggtccgtgacatcaacgaggcctttaaggagctggggcgcatgtgccaactgcacctc
aacagcgagaagccccagaccaaactgctcatcctgcaccaggctgtctcggtcatcctg
aacttggagcagcaagtgcgagagcggaacctgaatcccaaagcagcctgtttgaaacgg
cgagaagaggaaaaggtgtcaggtgtggttggagacccccagatggtgctttcagctccc
cacccaggcctgagcgaagcccacaaccccgccgggcacatgtga

DBGET integrated database retrieval system