KEGG   Homo sapiens (human): 6932Help
Entry
6932              CDS       T01001                                 

Gene name
TCF7, TCF-1
Definition
(RefSeq) transcription factor 7
  KO
K02620  transcription factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6932 (TCF7)
   04390 Hippo signaling pathway
    6932 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6932 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    6932 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    6932 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6932 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    6932 (TCF7)
   05225 Hepatocellular carcinoma
    6932 (TCF7)
   05226 Gastric cancer
    6932 (TCF7)
   05216 Thyroid cancer
    6932 (TCF7)
   05221 Acute myeloid leukemia
    6932 (TCF7)
   05217 Basal cell carcinoma
    6932 (TCF7)
   05215 Prostate cancer
    6932 (TCF7)
   05213 Endometrial cancer
    6932 (TCF7)
   05224 Breast cancer
    6932 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6932 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    6932 (TCF7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    6932 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6932 (TCF7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6932 (TCF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 6932
NCBI-ProteinID: NP_003193
OMIM: 189908
HGNC: 11639
Ensembl: ENSG00000081059
Vega: OTTHUMG00000129124
Pharos: P36402(Tbio)
UniProt: P36402 B3KQ75
LinkDB All DBs
Position
5q31.1
AA seq 384 aa AA seqDB search
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKET
VYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ
KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPS
GKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN
QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGG
KRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctggactccggcgggggcggcgcgggcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggatgaaggcgaggagcaggacgacaagagccgcgacagc
gccgccggtcccgagcgcgacctggccgagctcaagtcgtcgctcgtgaacgagtccgag
ggcgcggccggcggcgcagggatcccgggggtcccgggggccggcgccggggcccgcggc
gaggccgaggctctcgggcgggaacacgctgcgcagagactcttcccggacaaacttcca
gagcccctggaggacggcctgaaggccccggagtgcaccagcggcatgtacaaagagacc
gtctactccgccttcaatctgctcatgcattacccacccccctcgggagcagggcagcac
ccccagccgcagcccccgctgcacaaggccaatcagcccccccacggtgtcccccaactc
tctctctacgaacatttcaacagcccacatcccacccctgcacctgcggacatcagccag
aagcaagttcacaggcctctgcagacccctgacctctctggcttctactccctgacctca
ggcagcatggggcagctcccccacactgtgagctggttcacccacccatccttgatgcta
ggttctggtgtacctggtcacccagcagccatcccccacccggccattgtgcccccctca
gggaagcaggagctgcagcccttcgaccgcaacctgaagacacaagcagagtccaaggca
gagaaggaggccaagaagccaaccatcaagaagcccctcaatgccttcatgctgtacatg
aaggagatgagagccaaggtcattgcagagtgcacacttaaggagagcgctgccatcaac
cagatcctgggccgcaggtggcacgcgctgtcgcgagaagagcaggccaagtactatgag
ctggcccgcaaggagaggcagctgcacatgcagctatacccaggctggtcagcgcgggac
aactacgggaagaagaagaggcggtcgagggaaaagcaccaagaatccaccacaggagga
aaaagaaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccg
atgacagtgctctag

KEGG   Homo sapiens (human): 83439Help
Entry
83439             CDS       T01001                                 

Gene name
TCF7L1, TCF-3, TCF3
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    83439 (TCF7L1)
   04390 Hippo signaling pathway
    83439 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    83439 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    83439 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83439 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    83439 (TCF7L1)
   05225 Hepatocellular carcinoma
    83439 (TCF7L1)
   05226 Gastric cancer
    83439 (TCF7L1)
   05216 Thyroid cancer
    83439 (TCF7L1)
   05221 Acute myeloid leukemia
    83439 (TCF7L1)
   05217 Basal cell carcinoma
    83439 (TCF7L1)
   05215 Prostate cancer
    83439 (TCF7L1)
   05213 Endometrial cancer
    83439 (TCF7L1)
   05224 Breast cancer
    83439 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    83439 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    83439 (TCF7L1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    83439 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    83439 (TCF7L1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    83439 (TCF7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 83439
NCBI-ProteinID: NP_112573
OMIM: 604652
HGNC: 11640
Ensembl: ENSG00000152284
Vega: OTTHUMG00000130026
Pharos: Q9HCS4(Tbio)
UniProt: Q9HCS4
LinkDB All DBs
Position
2p11.2
AA seq 588 aa AA seqDB search
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggcggcggcggcggcagcgggggaggcggcggc
tccagcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatcccc
ttccaggacgaggggggcgaggagcaggagccgagcagcgatagcgcctcggcgcagcgg
gacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcg
gactcggaggcggagaggcgcccgcagcccgtccgggacactttccagaagccgcgggac
tatttcgccgaagtgagaaggcctcaggacagcgcgttctttaaaggacccccgtaccct
gggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctg
tctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctcc
agcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcct
gtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgac
cacttctcccccggctcccctcccacccacctctccccagagatcgatccaaagacagga
atcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccggagct
gtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtac
tcccttcctcccggtggcttccggcacccttaccccgccctcgccatgaacgcctcgatg
tccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggcctg
cccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggca
ccccccagcctgagccctgcagtgagcgtgaaatcaccagtcaccgtgaaaaaggaggag
gaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatcctt
ggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccgg
aaggagcggcagcttcactcgcagctctacccaacctggtcagcccgggacaactatggt
aagaaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaagtc
caggaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgccc
cccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccggcc
actccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcc
cagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgcc
gccttcctgtcggctaaggctgcagcctcctcctctgggcagatgggcagccagcctccc
ctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccg
tccttccccgccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctt
tccctggtcaccaagtctgcccactaa

KEGG   Homo sapiens (human): 6934Help
Entry
6934              CDS       T01001                                 

Gene name
TCF7L2, TCF-4, TCF4
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6934 (TCF7L2)
   04390 Hippo signaling pathway
    6934 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6934 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    6934 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6934 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    6934 (TCF7L2)
   05225 Hepatocellular carcinoma
    6934 (TCF7L2)
   05226 Gastric cancer
    6934 (TCF7L2)
   05216 Thyroid cancer
    6934 (TCF7L2)
   05221 Acute myeloid leukemia
    6934 (TCF7L2)
   05217 Basal cell carcinoma
    6934 (TCF7L2)
   05215 Prostate cancer
    6934 (TCF7L2)
   05213 Endometrial cancer
    6934 (TCF7L2)
   05224 Breast cancer
    6934 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6934 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    6934 (TCF7L2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    6934 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6934 (TCF7L2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6934 (TCF7L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 6934
NCBI-ProteinID: NP_001139746
OMIM: 602228
HGNC: 11641
Ensembl: ENSG00000148737
Vega: OTTHUMG00000019070
Pharos: Q9NQB0(Tbio)
UniProt: Q9NQB0
LinkDB All DBs
Structure
PDB: 

Position
10q25.2-q25.3
AA seq 602 aa AA seqDB search
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLL
AEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKS
LE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcaccg
gcacacattgtctctaacaaagtgccagtggtgcagcaccctcaccatgtccaccccctc
acgcctcttatcacgtacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatcc
ccgtattacccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggaggattcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccaggttccctccccatatggtcccacca
catcatacgctacacacgacgggcattccgcatccggccatagtcacaccaacagtcaaa
caggaatcgtcccagagtgatgtcggctcactccatagttcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaagaaagcgcggccatc
aaccagatccttgggcggaggtggcatgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcatatgcaactgtaccccggctggtccgcgcgg
gataactatggaaagaagaagaagaggaaaagggacaagcagccgggagagaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgaccgacagactttatggtgc
aaaccgtgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agcccaccctcttcagatggaagcttactagattcgcctcccccctccccgaacctgcta
ggctcccctccccgagacgccaagtcacagactgagcagacccagcctctgtcgctgtcc
ctgaagcccgaccccctggcccacctgtccatgatgcctccgccacccgccctcctgctc
gctgaggccacccacaaggcctccgccctctgtcccaacggggccctggacctgccccca
gccgctttgcagcctgccgccccctcctcatcaattgcacagccgtcgacttcttcctta
cattcccacagctccctggccgggacccagccccagccgctgtcgctcgtcaccaagtct
ttagaatag

KEGG   Homo sapiens (human): 51176Help
Entry
51176             CDS       T01001                                 

Gene name
LEF1, LEF-1, TCF10, TCF1ALPHA, TCF7L3
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    51176 (LEF1)
   04390 Hippo signaling pathway
    51176 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    51176 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    51176 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51176 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    51176 (LEF1)
   05225 Hepatocellular carcinoma
    51176 (LEF1)
   05226 Gastric cancer
    51176 (LEF1)
   05216 Thyroid cancer
    51176 (LEF1)
   05221 Acute myeloid leukemia
    51176 (LEF1)
   05217 Basal cell carcinoma
    51176 (LEF1)
   05215 Prostate cancer
    51176 (LEF1)
   05213 Endometrial cancer
    51176 (LEF1)
   05224 Breast cancer
    51176 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    51176 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    51176 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51176 (LEF1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    51176 (LEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 51176
NCBI-ProteinID: NP_057353
OMIM: 153245
HGNC: 6551
Ensembl: ENSG00000138795
Vega: OTTHUMG00000131809
Pharos: Q9UJU2(Tchem)
UniProt: Q9UJU2 A0A024RDI7 Q659G9
LinkDB All DBs
Position
4q25
AA seq 399 aa AA seqDB search
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcatcccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggtggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcatatgattcccggtcctcctggtccccacacaactggcatccctcat
ccagctattgtaacacctcaggtcaaacaggaacatccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgttgctgag
tgtactctaaaagaaagtgcagctatcaaccagattcttggcagaaggtggcatgccctc
tcccgtgaagagcaggctaaatattatgaattagcacggaaagaaagacagctacatatg
cagctttatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctgcatcaggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system