KEGG   Homo sapiens (human): 6934
Entry
6934              CDS       T01001                                 

Gene name
TCF7L2, TCF-4, TCF4
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05132  Salmonella infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
N01124  Salmonella AvrA to beta-catenin signaling pathway
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6934 (TCF7L2)
   04390 Hippo signaling pathway
    6934 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6934 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    6934 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6934 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    6934 (TCF7L2)
   05225 Hepatocellular carcinoma
    6934 (TCF7L2)
   05226 Gastric cancer
    6934 (TCF7L2)
   05216 Thyroid cancer
    6934 (TCF7L2)
   05221 Acute myeloid leukemia
    6934 (TCF7L2)
   05217 Basal cell carcinoma
    6934 (TCF7L2)
   05215 Prostate cancer
    6934 (TCF7L2)
   05213 Endometrial cancer
    6934 (TCF7L2)
   05224 Breast cancer
    6934 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    6934 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    6934 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6934 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    6934 (TCF7L2)
   05165 Human papillomavirus infection
    6934 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6934 (TCF7L2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6934 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 6934
NCBI-ProteinID: NP_001139746
OMIM: 602228
HGNC: 11641
Ensembl: ENSG00000148737
Vega: OTTHUMG00000019070
Pharos: Q9NQB0(Tbio)
UniProt: Q9NQB0
LinkDB
Structure
PDB: 
1JDH 1JPW 2GL7

Position
10q25.2-q25.3
AA seq 602 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLL
AEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKS
LE
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcaccg
gcacacattgtctctaacaaagtgccagtggtgcagcaccctcaccatgtccaccccctc
acgcctcttatcacgtacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatcc
ccgtattacccactatcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggaggattcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccaggttccctccccatatggtcccacca
catcatacgctacacacgacgggcattccgcatccggccatagtcacaccaacagtcaaa
caggaatcgtcccagagtgatgtcggctcactccatagttcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggtcgtagctgagtgcacgttgaaagaaagcgcggccatc
aaccagatccttgggcggaggtggcatgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcatatgcaactgtaccccggctggtccgcgcgg
gataactatggaaagaagaagaagaggaaaagggacaagcagccgggagagaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgaccgacagactttatggtgc
aaaccgtgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agcccaccctcttcagatggaagcttactagattcgcctcccccctccccgaacctgcta
ggctcccctccccgagacgccaagtcacagactgagcagacccagcctctgtcgctgtcc
ctgaagcccgaccccctggcccacctgtccatgatgcctccgccacccgccctcctgctc
gctgaggccacccacaaggcctccgccctctgtcccaacggggccctggacctgccccca
gccgctttgcagcctgccgccccctcctcatcaattgcacagccgtcgacttcttcctta
cattcccacagctccctggccgggacccagccccagccgctgtcgctcgtcaccaagtct
ttagaatag

DBGET integrated database retrieval system