KEGG   Homo sapiens (human): 6935
Entry
6935              CDS       T01001                                 

Gene name
ZEB1, AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H00960  Fuchs corneal dystrophy
H00961  Posterior polymorphous corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6935 (ZEB1)
   05206 MicroRNAs in cancer
    6935 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    6935 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6935 (ZEB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    6935 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2
Other DBs
NCBI-GeneID: 6935
NCBI-ProteinID: NP_110378
OMIM: 189909
HGNC: 11642
Ensembl: ENSG00000148516
Vega: OTTHUMG00000017907
Pharos: P37275(Tbio)
UniProt: P37275 B2RBI8
LinkDB
Structure
PDB: 
2E19

Position
10p11.22
AA seq 1124 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaattcagattcagatgatgaagacaaactgcat
attgtggaagaagaaagtgttacagatgcagctgactgtgaaggtgtaccagaggatgac
ctgccaacagaccagacagtgttaccagggaggagcagtgaaagagaagggaatgctaag
aactgctgggaggatgacagaaaggaagggcaagaaatcctggggcctgaagctcaggca
gatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgcagaaaatgagcaa
aaccatgatcctaatgttgaagagtttctacaacaacaagacactgctgtcatttttcct
gaggcacctgaagaggaccagaggcagggcacaccagaagccagtggtcatgatgaaaat
ggaacaccagatgcattttcacaattactcacctgtccatattgtgatagaggctataaa
cgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaatgaagataacttt
agttgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatgaca
tcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgtaatcgtaaattc
aaatgcactgagtgtggaaaagctttcaaatacaaacatcacctaaaagagcacttaaga
attcacagtggagagaagccatatgaatgcccaaactgcaagaaacgcttttcccattct
ggctcctatagctcacacataagcagtaagaaatgtatcagcttgatacctgtgaatggg
cgaccaagaacaggactcaagacatctcagtgttcttcaccgtctctttcagcatcacca
ggcagtcccacacgaccacagatacggcaaaagatagagaataaaccccttcaagaacaa
ctttctgttaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggttttcactggtggtggccca
ttacaggcaaccagttctcctcagggcatggtgcaagctgttgttctgccaacagttggt
ttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggcggta
gatggtaatgtaataaggcaagtgttggagaataatcaagccaatcttgcatccaaagaa
caagaaacaatcaatgcttcacccatacaacaaggtggccattctgttatttcagccatc
agtcttcctttggttgatcaagatggaacaaccaaaattatcatcaactacagtcttgag
cagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaatccagtcgctaca
aacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtctgagaaggacaaa
agctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgattgtccaggagat
attaatgcacttccagaattaaagcactatgacctaaagcagcctactcagcctcctcca
ctccctgcagcagaagctgagaagcctgagtcctctgtttcatcagctactggagatggc
aatttgtctcctagtcagccacctttaaagaacctcttgtctctcctaaaagcatattat
gctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgattcagtaaaccta
ccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttcagtgcag
tcttctgaaccatcttctcctgaaccaggcaaagtaaatatccctgccaagaacaatgat
cagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaatctacaaagtcct
ttgaagatgactaactccccagttttaccagtgggatcaaccaccaatggttccagaagt
agtacaccatccccatcacctctaaacctttcctcatccagaaatacacagggttacttg
tacacagctgagggtgcacaagaagagccacaagtagaacctcttgatctttcactacca
aagcaacagggagaattattagaaaggtcaactatcactagtgtttaccagaacagtgtt
tattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggagccacaaaaggac
agttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaaccccata
aatatcgctatacctacagtcactgcccagttacccacaatcgtggccattgctgaccag
aacagtgttccatgcttaagagcgctagctgccaataagcaaacgattctgattccccag
gtggcatacacctactcaactacggtcagccctgcagtccaagaaccacccttgaaagtg
atccagccaaatggaaatcaggatgaaagacaagatactagctcagaaggagtatcaaat
gtagaggatcagaatgactctgattctacaccgcccaaaaagaaaatgcggaagacagaa
aatggaatgtatgcttgtgatttgtgtgacaagatattccaaaagagtagttcattattg
agacataaatatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaaaaggca
tttaaacacaaacatcatttgattgaacacatgcgattacattctggagaaaagccctat
caatgtgacaaatgtggaaagcgcttctcacactctgggtcttattctcaacacatgaat
catcgctactcctactgtaagagagaagcggaagaacgtgacagcacagagcaggaagag
gcagggcctgaaatcctctcgaatgagcacgtgggtgccagggcgtctccctcacagggc
gactcggacgagagagagagtttgacaagggaagaggatgaagacagtgaaaaagaggaa
gaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgtgaaaaaccacaa
ggggatgaggaagaggaggaggaggaggaagaagtggaagaagaagaggtagaagaggca
gagaatgagggagaagaagcaaaaactgaaggtctgatgaaggatgacagggctgaaagt
caagcaagcagcttaggacaaaaagtaggcgagagtagtgagcaagtgtctgaagaaaag
acaaatgaagcctaa

DBGET integrated database retrieval system