KEGG   Homo sapiens (human): 7009Help
Entry
7009              CDS       T01001                                 

Gene name
TMBIM6, BAXI1, BI-1, TEGT
Definition
(RefSeq) transmembrane BAX inhibitor motif containing 6
  KO
K21889  Bax inhibitor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Network
nt06131  Apoptosis (viruses and bacteria)
  Element
N00938  Escherichia NleH to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7009 (TMBIM6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7009 (TMBIM6)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   7009 (TMBIM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bax1-I 7TMR-DISM_7TM
Motif
Other DBs
NCBI-GeneID: 7009
NCBI-ProteinID: NP_003208
OMIM: 600748
HGNC: 11723
Ensembl: ENSG00000139644
Vega: OTTHUMG00000169652
Pharos: P55061(Tbio)
UniProt: P55061 A0A024R0Z5
LinkDB All DBs
Position
12q13.12
AA seq 237 aa AA seqDB search
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLS
ALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMG
TAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVV
MCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatttgatcgaaagatcaactttgatgcgcttttaaaattttctcatataacc
ccgtcaacgcagcagcacctgaagaaggtctatgcaagttttgccctttgtatgtttgtg
gcggctgcaggggcctatgtccatatggtcactcatttcattcaggctggcctgctgtct
gccttgggctccctgatattgatgatttggctgatggcaacacctcatagccatgaaact
gaacagaaaagactgggacttcttgctggatttgcattccttacaggagttggcctgggc
cctgccctggagttttgtattgctgtcaaccccagcatccttcccactgctttcatgggc
acggcaatgatctttacctgcttcaccctcagtgcactctatgccaggcgccgtagctac
ctctttctgggaggtatcttgatgtcagccctgagcttgttgcttttgtcttccctgggg
aatgttttctttggatccatttggcttttccaggcaaacctgtatgtgggactggtggtc
atgtgtggcttcgtcctttttgatactcaactcattattgaaaaggccgaacatggagat
caagattatatctggcactgcattgatctcttcttagatttcattactgtcttcagaaaa
ctcatgatgatcctggccatgaatgaaaaggataagaagaaagagaagaaatga

DBGET integrated database retrieval system