KEGG   Homo sapiens (human): 7023Help
Entry
7023              CDS       T01001                                 

Gene name
TFAP4, AP-4, bHLHc41
Definition
(RefSeq) transcription factor AP-4
  KO
K09108  transcription factor AP-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    7023 (TFAP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7023 (TFAP4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    7023 (TFAP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH COE1_HLH
Motif
Other DBs
NCBI-GeneID: 7023
NCBI-ProteinID: NP_003214
OMIM: 600743
HGNC: 11745
Ensembl: ENSG00000090447
Vega: OTTHUMG00000129435
Pharos: Q01664(Tbio)
UniProt: Q01664
LinkDB All DBs
Position
16p13.3
AA seq 338 aa AA seqDB search
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAP
PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagtatttcatggtgcccactcagaaggtgccctctttgcaacatttcaggaaaaca
gagaaagaagtgataggagggctctgtagccttgccaacattccactaacccccgagact
cagcgggaccaggagcggcggattcggcgggagatcgccaacagcaacgagcggagacgc
atgcagagcatcaacgcgggattccagtccctcaagaccctcatcccccacacagacgga
gagaagctcagcaaggcagccattctccagcagacagccgagtacatcttctccctggag
caggagaagaccaggctcttgcagcagaacacacagctcaagcgcttcatccaggagctg
agcggctcgtcccccaagcgacggcgggcagaggacaaggacgaaggcataggctccccg
gacatctgggaggacgagaaggcggaggacctgcggcgggagatgattgagctgcggcag
cagctggacaaggagcgctcggtgcgcatgatgctggaggagcaggtgcgctcgctggag
gcccacatgtacccggaaaagctcaaggtgattgcgcagcaggtgcagctgcagcagcag
caggaacaggtgaggctgctgcaccaggagaagctggagcgggaacagcagcagctgcgg
acccagcttctgccccctccggcccccacccaccaccccacggtgatcgtgccagcaccg
cctcctcctccctcccaccacatcaatgtcgtcaccatgggcccctcctcggtcatcaac
tctgtttccacatcccggcaaaatctggacaccatcgtgcaggcaatccagcacatcgag
ggcacccaggaaaagcaggagctggaggaggagcagcggcgagctgtcatcgtgaagcct
gtccgcagctgcccggaggcccccacctctgacaccgcctccgactccgaggcctcagac
agtgacgccatggaccagagccgggaggagccgtcgggggacggggagcttccctga

DBGET integrated database retrieval system