KEGG   Homo sapiens (human): 7041
Entry
7041              CDS       T01001                                 

Gene name
TGFB1I1, ARA55, HIC-5, HIC5, TSC-5
Definition
(RefSeq) transforming growth factor beta 1 induced transcript 1
  KO
K24315  transforming growth factor beta-1-induced transcript 1 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    7041 (TGFB1I1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  Paxillin family proteins
   7041 (TGFB1I1)
SSDB
Motif
Pfam: LIM Paxillin DUF1631 zf-dskA_traR
Other DBs
NCBI-GeneID: 7041
NCBI-ProteinID: NP_001035919
OMIM: 602353
HGNC: 11767
Ensembl: ENSG00000140682
Vega: OTTHUMG00000132467
Pharos: O43294(Tbio)
UniProt: O43294
LinkDB
Position
16p11.2
AA seq 461 aa
MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPT
QPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggaggacctggatgccctgctctctgacctggagactaccacctcgcacatgccaagg
tcaggggctcccaaagagcgccctgcggagcctctcacccctcccccatcctatggccac
cagccacagacagggtctggggagtcttcaggagcctcgggggacaaggaccacctgtac
agcacggtatgcaagcctcggtccccaaagcctgcagccccggcggcccctccattctcc
tcttccagcggtgtcttgggtaccgggctctgtgagctagatcggttgcttcaggaactt
aatgccactcagttcaacatcacagatgaaatcatgtctcagttcccatctagcaaggtg
gcttcaggagagcagaaggaggaccagtctgaagataagaaaagacccagcctcccttcc
agcccgtctcctggcctcccaaaggcttctgccacctcagccactctggagctggataga
ctgatggcctcactctctgacttccgcgttcaaaaccatcttccagcctctgggccaact
cagccaccggtggtgagctccacaaatgagggctccccatccccaccagagccgactggc
aagggcagcctagacaccatgctggggctgctgcagtccgacctcagccgccggggtgtt
cccacccaggccaaaggcctctgtggctcctgcaataaacctattgctgggcaagtggtg
acggctctgggccgcgcctggcaccccgagcacttcgtttgcggaggctgttccaccgcc
ctgggaggcagcagcttcttcgagaaggatggagcccccttctgccccgagtgctacttt
gagcgcttctcgccaagatgtggcttctgcaaccagcccatccgacacaagatggtgacc
gccttgggcactcactggcacccagagcatttctgctgcgtcagttgcggggagcccttc
ggagatgagggtttccacgagcgcgagggccgcccctactgccgccgggacttcctgcag
ctgttcgccccgcgctgccagggctgccagggccccatcctggataactacatctcggcg
ctcagcgcgctctggcacccggactgtttcgtctgcagggaatgcttcgcgcccttctcg
ggaggcagctttttcgagcacgagggccgcccgttgtgcgagaaccacttccacgcacga
cgcggctcgctgtgcgccacgtgtggcctccctgtgaccggccgctgcgtgtcggccctg
ggtcgccgcttccacccggaccacttcacatgcaccttctgcctgcgcccgctcaccaag
gggtccttccaggagcgcgccggcaagccctactgccagccctgcttcctgaagctcttc
ggctga

DBGET integrated database retrieval system