KEGG   Homo sapiens (human): 7053Help
Entry
7053              CDS       T01001                                 

Gene name
TGM3, TGE, UHS2
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Disease
H01796  Uncombable hair syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    7053 (TGM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     7053 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 7053
NCBI-ProteinID: NP_003236
OMIM: 600238
HGNC: 11779
Ensembl: ENSG00000125780
Vega: OTTHUMG00000031690
Pharos: Q08188(Tchem)
UniProt: Q08188
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 693 aa AA seqDB search
MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD
ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctaggagtccagagtatcaactggcagacggccttcaaccgacaagcgcat
cacacagacaagttctccagccaggagctcatcttgcggagaggccaaaacttccaggtc
ttaatgatcatgaacaaaggccttggctctaacgaaagactggagttcattgtctccaca
gggccttacccctcagagtcggccatgacgaaggctgtgtttccactctccaatggcagt
agtggtggctggagtgcggtgcttcaggccagcaatggcaatactctgactatcagcatc
tccagtcctgccagcgcacccataggacggtacacaatggccctccagatcttctcccag
ggcggcatctcctctgtgaaacttgggacgttcatactgctttttaacccctggctgaat
gtggatagcgtctttatgggtaaccacgctgagagagaagagtatgttcaggaagatgcc
ggcatcatctttgtgggaagcacaaaccgaattggcatgattggctggaactttggacag
tttgaagaagacattctcagcatctgcctctcaatcttggataggagtctgaatttccgc
cgtgacgctgctactgatgtggccagcagaaatgaccccaaatacgttggccgggtgctg
agtgccatgatcaatagcaatgatgacaatggtgtgcttgctgggaattggagcggcact
tacaccggtggccgggacccaaggagctggaacggcagcgtggagatcctcaaaaattgg
aaaaaatctggcttcagcccagtccgatatggccagtgctgggtctttgctgggaccctc
aacacagcgctgcggtctttggggattccttcccgggtgatcaccaacttcaactcagct
catgacacagaccgaaatctcagtgtggatgtgtactacgaccccatgggaaaccccctg
gacaagggtagtgatagcgtatggaatttccatgtctggaatgaaggctggtttgtgagg
tctgacctgggcccctcgtacggtggatggcaggtgttggatgctaccccgcaggaaaga
agccaaggggtgttccagtgcggccccgcttcggtcattggtgttcgagagggtgatgtg
cagctgaacttcgacatgccctttatcttcgcggaggttaatgccgaccgcatcacctgg
ctgtacgacaacaccactggcaaacagtggaagaattccgtgaacagtcacaccattggc
aggtacatcagcaccaaggcggtgggcagcaatgctcgcatggacgtcacggacaagtac
aagtacccagaaggctctgaccaggaaagacaagtgttccaaaaggctttggggaaactt
aaacccaacacgccatttgccgcgacgtcttcaatgggtttggaaacagaggaacaggag
cccagcatcatcgggaagctgaaggtcgctggcatgctggcagtaggcaaagaagtcaac
ctggtcctactgctcaaaaacctgagcagggatacgaagacagtgacagtgaacatgaca
gcctggaccatcatctacaacggcacgcttgtacatgaagtgtggaaggactctgccaca
atgtccctggaccctgaggaagaggcagaacatcccataaagatctcgtacgctcagtat
gagaagtacctgaagtcagacaacatgatccggatcacagcggtgtgcaaggtcccagat
gagtctgaggtggtggtggagcgggacatcatcctggacaaccccaccttgaccctggag
gtgctgaacgaggctcgtgtgcggaagcctgtgaacgtgcagatgctcttctccaatcca
ctggatgagccggtgagggactgcgtgctgatggtggagggaagcggcctgctgttgggt
aacctgaagatcgacgtgccgaccctagggcccaaggaggggtcccgggtccgttttgat
atcctgccctcccggagtggcaccaagcaactgctcgccgacttctcctgcaacaagttc
cctgcaatcaaggccatgttgtccatcgatgtagccgaatga

DBGET integrated database retrieval system