KEGG   Homo sapiens (human): 7056
Entry
7056              CDS       T01001                                 

Gene name
THBD, AHUS6, BDCA-3, BDCA3, CD141, THPH12, THRM, TM
Definition
(RefSeq) thrombomodulin
  KO
K03907  thrombomodulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00223  Inherited thrombophilia
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    7056 (THBD)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7056 (THBD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7056 (THBD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    7056 (THBD)
   00535 Proteoglycans [BR:hsa00535]
    7056 (THBD)
   04091 Lectins [BR:hsa04091]
    7056 (THBD)
CD molecules [BR:hsa04090]
 Proteins
  7056 (THBD)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   7056 (THBD)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 14: Thrombomodulin
   7056 (THBD)
SSDB
Motif
Pfam: FXa_inhibition Tme5_EGF_like cEGF EGF_CA EGF Lectin_C
Other DBs
NCBI-GeneID: 7056
NCBI-ProteinID: NP_000352
OMIM: 188040
HGNC: 11784
Ensembl: ENSG00000178726
Vega: OTTHUMG00000032053
Pharos: P07204(Tbio)
UniProt: P07204
LinkDB
Structure
PDB: 

Position
20p11.21
AA seq 575 aa
MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM
TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS
RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAV
EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP
GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP
DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG
ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC
DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR
KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcttggggtcctggtccttggcgcgctggccctggccggcctggggttccccgcaccc
gcagagccgcagccgggtggcagccagtgcgtcgagcacgactgcttcgcgctctacccg
ggccccgcgaccttcctcaatgccagtcagatctgcgacggactgcggggccacctaatg
acagtgcgctcctcggtggctgccgatgtcatttccttgctactgaacggcgacggcggc
gttggccgccggcgcctctggatcggcctgcagctgccacccggctgcggcgaccccaag
cgcctcgggcccctgcgcggcttccagtgggttacgggagacaacaacaccagctatagc
aggtgggcacggctcgacctcaatggggctcccctctgcggcccgttgtgcgtcgctgtc
tccgctgctgaggccactgtgcccagcgagccgatctgggaggagcagcagtgcgaagtg
aaggccgatggcttcctctgcgagttccacttcccagccacctgcaggccactggctgtg
gagcccggcgccgcggctgccgccgtctcgatcacctacggcaccccgttcgcggcccgc
ggagcggacttccaggcgctgccggtgggcagctccgccgcggtggctcccctcggctta
cagctaatgtgcaccgcgccgcccggagcggtccaggggcactgggccagggaggcgccg
ggcgcttgggactgcagcgtggagaacggcggctgcgagcacgcgtgcaatgcgatccct
ggggctccccgctgccagtgcccagccggcgccgccctgcaggcagacgggcgctcctgc
accgcatccgcgacgcagtcctgcaacgacctctgcgagcacttctgcgttcccaacccc
gaccagccgggctcctactcgtgcatgtgcgagaccggctaccggctggcggccgaccaa
caccggtgcgaggacgtggatgactgcatactggagcccagtccgtgtccgcagcgctgt
gtcaacacacagggtggcttcgagtgccactgctaccctaactacgacctggtggacggc
gagtgtgtggagcccgtggacccgtgcttcagagccaactgcgagtaccagtgccagccc
ctgaaccaaactagctacctctgcgtctgcgccgagggcttcgcgcccattccccacgag
ccgcacaggtgccagatgttttgcaaccagactgcctgtccagccgactgcgaccccaac
acccaggctagctgtgagtgccctgaaggctacatcctggacgacggtttcatctgcacg
gacatcgacgagtgcgaaaacggcggcttctgctccggggtgtgccacaacctccccggt
accttcgagtgcatctgcgggcccgactcggcccttgcccgccacattggcaccgactgt
gactccggcaaggtggacggtggcgacagcggctctggcgagcccccgcccagcccgacg
cccggctccaccttgactcctccggccgtggggctcgtgcattcgggcttgctcataggc
atctccatcgcgagcctgtgcctggtggtggcgcttttggcgctcctctgccacctgcgc
aagaagcagggcgccgccagggccaagatggagtacaagtgcgcggccccttccaaggag
gtagtgctgcagcacgtgcggaccgagcggacgccgcagagactctga

DBGET integrated database retrieval system