KEGG   Homo sapiens (human): 7059Help
Entry
7059              CDS       T01001                                 

Gene name
THBS3, TSP3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7059 (THBS3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7059 (THBS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7059 (THBS3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7059 (THBS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7059 (THBS3)
  09174 Infectious disease: parasitic
   05144 Malaria
    7059 (THBS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7059 (THBS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7059 (THBS3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7059 (THBS3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7059 (THBS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7059 (THBS3)
  Exosomal proteins of colorectal cancer cells
   7059 (THBS3)
  Exosomal proteins of bladder cancer cells
   7059 (THBS3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   7059 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 7059
NCBI-ProteinID: NP_009043
OMIM: 188062
HGNC: 11787
Ensembl: ENSG00000169231
Vega: OTTHUMG00000035710
Pharos: P49746(Tbio)
UniProt: P49746
LinkDB All DBs
Position
1q22
AA seq 956 aa AA seqDB search
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctttttcacatct
gccagtcaggatctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccttgctcactgctggggacatctacctcttatcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacactcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcgggcctggctgatggg
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgccctacat
ctctacgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcggaggtcgatgggctggagattaggactggacagaaggcgtatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcagtgaccaatgcactg
cactccattctaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccag
atcctggtggagctgcgggatgatatacgagaccaggtgaaggaaatgtccctgatccga
aacaccattatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aatccctgcttccgaggtgtggactgcatggaagtgtacgagtacccaggctaccgctgt
gggccctgcccccctggcctgcagggcaacggcacccactgcagtgacatcaatgagtgt
gctcacgctgacccctgtttcccgggctccagctgcatcaacaccatgcccggcttccac
tgtgaggcctgtcctcgagggtacaagggcacacaggtgtctggtgtgggcattgactat
gcccgggccagcaaacaggtctgcaatgacatcgatgaatgcaacgatggcaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgc
cgcctgggtttcctgggcaaccagagccagggctgcctcccagcccggacctgccacagc
ccagcccacagcccctgccacatccatgctcactgtctctttgaacgcaatggtgcagtg
tcctgccagtgtaacgtgggctgggctgggaatgggaacgtgtgtgggactgacacagac
atcgatggctacccagaccaagcactgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgatgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaagaccagcagaactcagatacagattcatttggtgatgcctgtgac
aattgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaacccactacagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgatactaatgaagacagcgatggggatgggcatcaggacaccaaggacaactgccca
cagctgccaaatagctcccagctggactctgataacgatggacttggagatgagtgtgat
ggggatgatgacaatgatggcatcccagattatgtgcctcctggtcccgataactgccgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgctgtggtcgaccccctggatgtgtgtcctgaaagtgcagag
gtaacgcttacggattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggttgtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccctggcttggcagttggatacacggccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactacgcaggctttctcttcagttatcaagac
agtggccgcttctacgtagtcatgtggaagcagaccgagcagacctactggcaggctaca
cccttccgggcggttgcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccgaaatgccctgtggcatactggccacacccctgatcaggtacga
ctgctgtggacagacccacgaaatgtgggctggcgggacaagacctcctatcgctggcag
cttctgcaccggcctcaagttggctacattcgggtgaagctctatgagggaccccagctt
gtggcggattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacataatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagggtgtga

DBGET integrated database retrieval system