KEGG   Homo sapiens (human): 7060Help
Entry
7060              CDS       T01001                                 

Gene name
THBS4, TSP-4, TSP4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7060 (THBS4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7060 (THBS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7060 (THBS4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7060 (THBS4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7060 (THBS4)
  09174 Infectious disease: parasitic
   05144 Malaria
    7060 (THBS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7060 (THBS4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7060 (THBS4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7060 (THBS4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7060 (THBS4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7060 (THBS4)
  Exosomal proteins of colorectal cancer cells
   7060 (THBS4)
  Exosomal proteins of bladder cancer cells
   7060 (THBS4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   7060 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF
Motif
Other DBs
NCBI-GeneID: 7060
NCBI-ProteinID: NP_003239
OMIM: 600715
HGNC: 11788
Ensembl: ENSG00000113296
Vega: OTTHUMG00000108173
Pharos: P35443(Tbio)
UniProt: P35443
LinkDB All DBs
Position
5q14.1
AA seq 961 aa AA seqDB search
MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGSLELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccgtcctcctgctgcacctggtcctgcagcggtggcta
gcggcaggcgcccaggccaccccccaggtctttgaccttctcccatcttccagtcagagg
ctaaacccaggcgctctgctgccagtcctgacagaccccgccctgaatgatctctatgtg
atttccaccttcaagctgcagactaaaagttcagccaccatcttcggtctttactcttca
actgacaacagtaaatattttgaatttactgtgatgggacgcttaaacaaagccatcctc
cgttacctgaagaacgatgggaaggtgcatttggtggttttcaacaacctgcagctggca
gacggaaggcggcacaggatcctcctgaggctgagcaatttgcagcgaggggccggctcc
ctagagctctacctggactgcatccaggtggattccgttcacaatctccccagggccttt
gctggcccctcccagaaacctgagaccattgaattgaggactttccagaggaagccacag
gacttcttggaagagctgaagctggtggtgagaggctcactgttccaggtggccagcctg
caagactgcttcctgcagcagagtgagccactggctgccacaggcacaggggactttaac
cggcagttcttgggtcaaatgacacaattaaaccaactcctgggagaggtgaaggacctt
ctgagacagcaggttaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcaagtttcagtctccgaccccaagcacggtggtgcccccggctccccct
gcaccgccaacacgcccacctcgtcggtgtgactccaacccatgtttccgaggtgtccaa
tgtaccgacagtagagatggcttccagtgtgggccctgccccgagggctacacaggaaac
gggatcacctgtattgatgttgatgagtgcaaataccatccctgctacccgggcgtgcac
tgcataaatttgtctcctggcttcagatgtgacgcctgcccagtgggcttcacagggccc
atggtgcagggtgttgggatcagttttgccaagtcaaacaagcaggtctgcactgacatt
gatgagtgtcgaaatggagcgtgcgttcccaactcgatctgcgttaatactttgggatct
taccgctgtgggccttgtaagccggggtatactggtgatcagataaggggatgcaaagcg
gaaagaaactgcagaaacccagagctgaacccttgcagtgtgaatgcccagtgcattgaa
gagaggcagggggatgtgacatgtgtgtgtggagtcggttgggctggagatggctatatc
tgtggaaaggatgtggacatcgacagttaccccgacgaagaactgccatgctctgccagg
aactgtaaaaaggacaactgcaaatatgtgccaaattctggccaagaagatgcagacaga
gatggcattggcgacgcttgtgacgaggatgctgacggagatgggatcctgaatgagcag
gataactgtgtcctgattcataatgtggaccaaaggaacagcgataaagatatctttggg
gatgcctgtgataactgcctgagtgtcttaaataacgaccagaaagacaccgatggggat
ggaagaggagatgcctgtgatgatgacatggatggagatggaataaaaaacattctggac
aactgcccaaaatttcccaatcgtgaccaacgggacaaggatggtgatggtgtgggggat
gcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggataatgatctg
gttggggactcctgtgacaccaatcaggacagtgatggagatgggcaccaggacagcaca
gacaactgccccaccgtcattaacagtgcccagctggacaccgataaggatggaattggt
gacgagtgtgatgatgatgatgacaatgatggtatcccagacctggtgccccctggacca
gacaactgccggctggtccccaacccagcccaggaggatagcaacagcgacggagtggga
gacatctgtgagtctgactttgaccaggaccaggtcatcgatcggatcgacgtctgccca
gagaacgcagaggtcaccctgaccgacttcagggcttaccagaccgtggtcctggatcct
gaaggggatgcccagatcgatcccaactgggtggtcctgaaccagggcatggagattgta
cagaccatgaacagtgatcctggcctggcagtggggtacacagcttttaatggagttgac
ttcgaagggaccttccatgtgaatacccagacagatgatgactatgcaggctttatcttt
ggctaccaagatagctccagcttctacgtggtcatgtggaagcagacggagcagacatat
tggcaagccaccccattccgagcagttgcagaacctggcattcagctcaaggctgtgaag
tctaagacaggtccaggggagcatctccggaactccctgtggcacacgggggacaccagt
gaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaaggtgtcc
taccgctggttcctacagcacaggccccaggtgggctacatcagggtacgattttatgaa
ggctctgagttggtggctgactctggcgtcaccatagacaccacaatgcgtggaggccga
cttggcgttttctgcttctctcaagaaaacatcatctggtccaacctcaagtatcgctgc
aatgacaccatccctgaggacttccaagagtttcaaacccagaatttcgaccgcttcgat
aattaa

DBGET integrated database retrieval system