KEGG   Homo sapiens (human): 7082
Entry
7082              CDS       T01001                                 

Gene name
TJP1, ZO-1
Definition
(RefSeq) tight junction protein 1
  KO
K05701  tight junction protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04540  Gap junction
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01287  Tight junction-Actin signaling pathway
N01288  Escherichia EspF to Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    7082 (TJP1)
   04530 Tight junction
    7082 (TJP1)
   04540 Gap junction
    7082 (TJP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    7082 (TJP1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    7082 (TJP1)
   05130 Pathogenic Escherichia coli infection
    7082 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7082 (TJP1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     7082 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 7082
NCBI-ProteinID: NP_003248
OMIM: 601009
HGNC: 11827
Ensembl: ENSG00000104067
Vega: OTTHUMG00000137397
Pharos: Q07157(Tbio)
UniProt: Q07157 Q6MZU1
LinkDB
Structure
PDB: 

Position
15q13.1
AA seq 1748 aa
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHAD
DHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPT
PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLK
QPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRY
EDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSY
DSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYE
QVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK
PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHD
KTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHL
SEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQ
PVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYP
QKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHK
PDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSA
VEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS
ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANC
VSVLIDHF
NT seq 5247 nt   +upstreamnt  +downstreamnt
atgtccgccagagctgcggccgccaagagcacagcaatggaggaaacagctatatgggaa
caacatacagtgacgcttcacagggctcctggatttggatttggaattgcaatatctggt
ggacgagataatcctcattttcagagtggggaaacgtcaatagtgatttcagatgtgctg
aaaggaggaccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataatgttgaacatgcttttgctgttcagcaactaaggaaaagtgggaaa
aatgcaaaaattacaattagaaggaagaagaaagttcaaataccagtaagtcgtcctgat
cctgaaccagtatctgataatgaagaagatagttatgatgaggaaatacatgatccaaga
agtggccggagtggtgtggttaacagaaggagtgagaagatttggccgagggatagaagt
gcaagtagagagaggagcttgtccccgcggtcagacaggcggtcagtggcttccagccag
cctgctaaacctactaaagtcacactggtgaaatcccggaaaaatgaagaatatggtctt
cgattggcaagccatatatttgttaaggaaatttcacaagatagtttggcagcaagagat
ggcaatattcaagaaggtgatgttgtattgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaagacattgatagaaaggtctaaaggcaaattaaaaatggtagtt
caaagagatgaacgggctacgctattgaatgtccctgatctttctgacagcatccactct
gctaatgcctctgagagagacgacatttcagaaattcagtcactggcatcagatcattct
ggtcgatcacacgataggcctccccgccgcagccggtcacgatctcctgaccagcggtca
gagccttctgatcattccaggcactcgccgcagcagccaagcaatggcagtctccggagt
agagatgaagagagaatttctaaacctggggctgtctcaactcctgtaaagcatgctgat
gatcacacacctaaaacagtggaagaagttacagttgaaagaaatgagaaacaaacacct
tctcttccagaaccaaagcctgtgtatgcccaagttgggcaaccagatgtggatttacct
gtcagtccatctgatggtgtcctacctaattcaactcatgaagatgggattcttcggccc
agcatgaaattggtaaaattcagaaaaggagatagtgtgggtttgcggctggctggtgga
aatgatgttggaatatttgtagctggcgttctagaagatagccctgcagccaaggaaggc
ttagaggaaggtgatcaaattctcagggtaaacaacgtagattttacaaatatcataaga
gaagaagccgtccttttcctgcttgacctccctaaaggagaagaagtgaccatattggct
cagaagaagaaggatgtttatcgtcgcattgtagaatcagatgtaggagattctttctat
attagaacccattttgaatatgaaaaggaatctccctatggacttagttttaacaaagga
gaggtgttccgtgttgtggataccttgtacaatggaaaactgggctcttggcttgctatt
cgaattggtaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gagcagctagccagtgtacagtatacacttccaaaaacagcaggcggagaccgtgctgac
ttctggagattcagaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggat
ttgtccgctcagcctgttcaaacaaagtttccagcttatgaaagagtggttcttcgagaa
gctggatttctgaggcctgtaaccatttttggaccaatagctgatgttgccagagaaaag
ctggcaagagaagaaccagatatttatcaaattgcaaagagtgaaccacgagacgctgga
actgaccaacgtagctctggcattattcgcctgcatacaataaagcaaatcatagatcaa
gacaaacatgctttattagatgtaacaccaaatgcagttgatcgtcttaactatgcccag
tggtatccaattgttgtatttcttaaccctgattctaagcaaggagtaaaaacaatgaga
atgaggttatgtccagaatctcggaaaagtgccaggaagttatacgagcgatctcataaa
cttcgtaaaaataatcaccatctttttacaactacaattaacttaaattcaatgaatgat
ggttggtatggtgcgctgaaagaagcaattcaacaacagcaaaaccagctggtatgggtt
tccgagggaaaggcggatggtgctacaagtgatgaccttgatttgcatgatgatcgtctg
tcctacctgtcagctccaggtagtgaatactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagacacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggttgggactccaccggagtctgccattacacggtcctctgagcct
gtaagagaggactcctctggaatgcatcatgaaaaccaaacatatcctccttactcacca
caagcgcagccacaaccaattcatagaatagactcccctggatttaagccagcctctcaa
cagaaagcagaagcttcatctccagtcccttacctttcgcctgaaacaaacccagcatca
tcaacctctgctgttaatcataatgtaaatttaactaatgtcagactggaggagcccacc
ccagctccttccacctcttactcaccacaagctgattctttaagaacaccaagtactgag
gcagctcacataatgctaagagatcaagaaccatcattgtcgtcgcatgtagatccaaca
aaggtgtatagaaaggatccatatcccgaggaaatgatgaggcagaaccatgttttgaaa
cagccagccgttagtcacccagggcacaggccagacaaagagcctaatctgacctatgaa
ccccaactcccatacgtagagaaacaagccagcagagacctcgagcagcccacatacaga
tacgagtcctcaagctatacggaccagttttctcgaaactatgaacatcgtctgcgatac
gaagatcgcgtccccatgtatgaagaacagtggtcatattatgatgacaaacagccctac
ccatctcggccaccttttgataatcagcactctcaagaccttgactccagacagcatccc
gaagagtcctcagaacgagggtactttccacgttttgaagagccagcccctctgtcttac
gacagcagaccacgttacgaacaggcacctagagcatccgccctgcggcacgaagagcag
ccagctcctgggtatgacacacatggtagactcagaccggaagcccagccccacccttca
gcagggcccaagcctgcagagtccaagcagtattttgagcaatattcacgcagttacgag
caagtaccaccccaaggatttacctctagagcaggtcattttgagcctctccatggtgct
gcagctgtccctccgctgataccttcatctcagcataagccagaagctctgccttcaaac
accaaaccactgcctccacccccaactcaaaccgaagaagaggaagatccagcaatgaag
ccacagtctgtactcaccagagttaagatgtttgaaaacaaaagatctgcatccttagag
accaagaaggatgtaaatgacactggcagttttaagcctccagaagtagcatctaaacct
tcaggtgctcccatcattggtcccaaacccacttctcagaatcaattcagtgaacatgac
aaaactctgtacaggatcccagaacctcaaaaacctcaactgaagccacctgaagatatt
gttcggtccaatcattatgaccctgaagaagatgaagaatattatcgaaaacagctgtca
tactttgaccgaagaagttttgagaataagcctcctgcacacattgccgccagccatctc
tccgagcctgcaaagccagcgcattctcagaatcaatcaaatttttctagttattcttca
aagggaaagcctcctgaagctgatggtgtggatagatcatttggcgagaaacgctatgaa
cccatccaggccactccccctcctcctccattgccctcgcagtatgcccagccatctcag
cctgtcaccagcgcgtctctccacatacattctaagggagcacatggtgaaggtaattca
gtgtcattggattttcagaattccttagtgtccaaaccagacccacctccatctcagaat
aagccagcaactttcagaccaccaaaccgagaagatactgctcaggcagctttctatccc
cagaaaagttttccagataaagccccagttaatggaactgaacagactcagaaaacagtc
actccagcatacaatcgattcacaccaaaaccatatacaagttctgcccgaccatttgaa
cgcaagtttgaaagtcctaaattcaatcacaatcttctgccaagtgaaactgcacataaa
cctgacttgtcttcaaaaactcccacttctccaaaaactcttgtgaaatcgcacagtttg
gcacagcctcctgagtttgacagtggagttgaaactttctctatccatgcagagaagcct
aaatatcaaataaataatatcagcacagtgcctaaagctattcctgtgagtccttcagct
gtggaagaggatgaagatgaagatggtcatactgtggtggccacagcccgaggcatattt
aacagcaatgggggcgtgctgagttccatagaaactggtgttagtataattatccctcaa
ggagccattcccgaaggagttgagcaggaaatctatttcaaggtctgccgggacaacagc
atccttccacctttagataaagagaaaggtgaaacactgctgagtcctttggtgatgtgt
ggtccccatggcctcaagttcctgaagcctgtggagctgcgcttaccacactgtgatcct
aaaacctggcaaaacaagtgtcttcccggagatccaaattatctcgttggagcaaactgt
gtttctgtccttattgaccacttttaa

KEGG   Homo sapiens (human): 9414
Entry
9414              CDS       T01001                                 

Gene name
TJP2, C9DUPq21.11, DFNA51, DUP9q21.11, PFIC4, X104, ZO2
Definition
(RefSeq) tight junction protein 2
  KO
K06098  tight junction protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05110  Vibrio cholerae infection
Disease
H00624  Progressive familial intrahepatic cholestasis
H01935  Familial hypercholanemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9414 (TJP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    9414 (TJP2)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1
Other DBs
NCBI-GeneID: 9414
NCBI-ProteinID: NP_004808
OMIM: 607709
HGNC: 11828
Ensembl: ENSG00000119139
Vega: OTTHUMG00000019978
Pharos: Q9UDY2(Tbio)
UniProt: Q9UDY2
LinkDB
Structure
PDB: 
3E17 2OSG

Position
9q21.11
AA seq 1190 aa
MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENG
ETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR
KVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRP
HERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRS
RGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSREHPHSRSPSPEPR
GRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTEN
MSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQ
EDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQE
GTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILA
CGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGNWLAVRIGNELEKGLIP
NKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYE
RVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKSTGVVRLNTVR
QIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDR
MSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEE
SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPS
AVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLG
KVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPP
EPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgccggtgcgaggagaccgcgggtttccaccccggcgggagctgtcaggttggctccgc
gccccaggcatggaagagctgatatgggaacagtacactgtgaccctacaaaaggattcc
aaaagaggatttggaattgcagtgtccggaggcagagacaacccccactttgaaaatgga
gaaacgtcaattgtcatttctgatgtgctcccgggtgggcctgctgatgggctgctccaa
gaaaatgacagagtggtcatggtcaatggcacccccatggaggatgtgcttcattcgttt
gcagttcagcagctcagaaaaagtgggaaggtcgctgctattgtggtcaagaggccccgg
aaggtccaggtggccgcacttcaggccagccctcccctggatcaggatgaccgggctttt
gaggtgatggacgagtttgatggcagaagtttccggagtggctacagcgagaggagccgg
ctgaacagccatggggggcgcagccgcagctgggaggacagcccggaaagggggcgtccc
catgagcgggcccggagccgggagcgggacctcagccgggaccggagccgtggccggagc
ctggagcggggcctggaccaagaccatgcgcgcacccgagaccgcagccgtggccggagc
ctggagcggggcctggaccacgactttgggccatcccgggaccgggaccgtgaccgcagc
cgcggccggagcattgaccaggactacgagcgagcctatcaccgggcctacgacccagac
tacgagcgggcctacagcccggagtacaggcgcggggcccgccacgatgcccgctctcgg
ggaccccgaagccgcagccgcgagcacccgcactcacggagccccagccccgagcctagg
gggcggccggggcccatcggggtcctcctgatgaaaagcagagcgaacgaagagtatggt
ctccggcttgggagtcagatcttcgtaaaggaaatgacccgaacgggtctggcaactaaa
gatggcaaccttcacgaaggagacataattctcaagatcaatgggactgtaactgagaac
atgtctttaacggatgctcgaaaattgatagaaaagtcaagaggaaaactacagctagtg
gtgttgagagacagccagcagaccctcatcaacatcccgtcattaaatgacagtgactca
gaaatagaagatatttcagaaatagagtcaaaccgatcattttctccagaggagagacgt
catcagtattctgattatgattatcattcctcaagtgagaagctgaaggaaaggccaagt
tccagagaggacacgccgagcagattgtccaggatgggtgcgacacccactccctttaag
tccacaggggatattgcaggcacagttgtcccagagaccaacaaggaacccagataccaa
gaggaccccccagctcctcaaccaaaagcagccccgagaacttttcttcgtcctagtcct
gaagatgaagcaatatatggccctaataccaaaatggtaaggttcaagaagggagacagc
gtgggcctccggttggctggtggcaatgatgtcgggatatttgttgctggcattcaagaa
gggacctcggcggagcaggagggccttcaagaaggagaccagattctgaaggtgaacaca
caggatttcagaggattagtgcgggaggatgccgttctctacctgttagaaatccctaaa
ggtgaaatggtgaccattttagctcagagccgagccgatgtgtatagagacatcctggct
tgtggcagaggggattcgttttttataagaagccactttgaatgtgagaaggaaactcca
cagagcctggccttcaccagaggggaggtcttccgagtggtagacacactgtatgacggc
aagctgggcaactggctggctgtgaggattgggaacgagttggagaaaggcttaatcccc
aacaagagcagagctgaacaaatggccagtgttcaaaatgcccagagagacaacgctggg
gaccgggcagatttctggagaatgcgtggccagaggtctggggtgaagaagaacctgagg
aaaagtcgggaagacctcacagctgttgtgtctgtcagcaccaagttcccagcttatgag
agggttttgctgcgagaagctggtttcaagagacctgtggtcttattcggccccatagct
gatatagcaatggaaaaattggctaatgagttacctgactggtttcaaactgctaaaacg
gaaccaaaagatgcaggatctgagaaatccactggagtggtccggttaaataccgtgagg
caaattattgaacaggataagcatgcactactggatgtgactccgaaagctgtggacctg
ttgaattacacccagtggttcccaattgtgatttttttcaacccagactccagacaaggt
gtcaaaaccatgagacaaaggttaaatccaacgtccaacaaaagttctcgaaagttattt
gatcaagccaacaagcttaaaaaaacgtgtgcacacctttttacagctacaatcaaccta
aattcagccaatgatagctggtttggcagcttaaaggacactattcagcatcagcaagga
gaagcggtttgggtctctgaaggaaagatggaagggatggatgatgaccccgaagaccgc
atgtcctacttaaccgccatgggcgcggactatctgagttgcgacagccgcctcatcagt
gactttgaagacacggacggtgaaggaggcgcctacactgacaatgagctggatgagcca
gccgaggagccgctggtgtcgtccatcacccgctcctcggagccggtgcagcacgaggag
agcataaggaaacccagcccagagccacgagctcagatgaggagggctgctagcagcgat
caacttagggacaatagcccgcccccagcattcaagccagagccgcccaaggccaaaacc
cagaacaaagaagaatcctatgacttctccaaatcctatgaatataagtcaaacccctct
gccgttgctggtaatgaaactcctggggcatctaccaaaggttatcctcctcctgttgca
gcaaaacctacctttgggcggtctatactgaagccctccactcccatccctcctcaagag
ggtgaggaggtgggagagagcagtgaggagcaagataatgctcccaaatcagtcctgggc
aaagtcaaaatatttgagaagatggatcacaaggccaggttacagagaatgcaggagctc
caggaagcacagaatgcaaggatcgaaattgcccagaagcatcctgatatctatgcagtt
ccaatcaaaacgcacaagccagaccctggcacgccccagcacacgagttccagaccccct
gagccacagaaagctccttccagaccttatcaggataccagaggaagttatggcagtgat
gccgaggaggaggagtaccgccagcagctgtcagaacactccaagcgcggttactatggc
cagtctgcccgataccgggacacagaattatag

DBGET integrated database retrieval system