KEGG   Homo sapiens (human): 7083
Entry
7083              CDS       T01001                                 

Gene name
TK1, TK2
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    7083 (TK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7083 (TK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     7083 (TK1)
SSDB
Motif
Pfam: TK AAA_14 ATPase_2
Other DBs
NCBI-GeneID: 7083
NCBI-ProteinID: NP_003249
OMIM: 188300
HGNC: 11830
Ensembl: ENSG00000167900
Vega: OTTHUMG00000150674
Pharos: P04183(Tchem)
UniProt: P04183 A0A384MDV9
LinkDB
Structure
PDB: 
1W4R 2WVJ 2ORV 1XBT

Position
17q25.3
AA seq 234 aa
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagctgcattaacctgcccactgtgctgcctggctcccccagcaagacccgggggcag
atccaggtgattctcgggccgatgttctcaggaaaaagcacagagttgatgagacgcgtc
cgtcgcttccagattgctcagtacaagtgcctggtgatcaagtatgccaaagacactcgc
tacagcagcagcttctgcacacatgaccggaacaccatggaggcactgcccgcctgcctg
ctccgagacgtggcccaggaggccctgggcgtggctgtcataggcatcgacgaggggcag
tttttccctgacatcgtggagttctgcgaggccatggccaacgccgggaagaccgtaatt
gtggctgcactggatgggaccttccagaggaagccatttggggccatcctgaacctggtg
ccgctggccgagagcgtggtgaagctgacggcggtgtgcatggagtgcttccgggaagcc
gcctataccaagaggctcggcacagagaaggaggtcgaggtgattgggggagcagacaag
taccactccgtgtgtcggctctgctacttcaagaaggcctcaggccagcctgccgggccg
gacaacaaagagaactgcccagtgccaggaaagccaggggaagccgtggctgccaggaag
ctctttgccccacagcagattctgcaatgcagccctgccaactga

KEGG   Homo sapiens (human): 7084
Entry
7084              CDS       T01001                                 

Gene name
TK2, MTDPS2, MTTK, PEOB3, SCA31
Definition
(RefSeq) thymidine kinase 2
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Disease
H00469  Mitochondrial DNA depletion syndrome
H01395  Autosomal recessive progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    7084 (TK2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7084 (TK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     7084 (TK2)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_17 AAA_22 CoaE
Other DBs
NCBI-GeneID: 7084
NCBI-ProteinID: NP_004605
OMIM: 188250
HGNC: 11831
Ensembl: ENSG00000166548
Vega: OTTHUMG00000137499
Pharos: O00142(Tchem)
UniProt: O00142 Q8IZR3
LinkDB
Position
16q21
AA seq 265 aa
MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIA
SGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDR
HTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIV
YLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHH
MERMLELFEQNRDRILTPENRKHCP
NT seq 798 nt   +upstreamnt  +downstreamnt
atgctgctgtggccgctgcggggctgggccgcccgggcgctgcgctgctttgggccggga
agtcgcgggagcccggcctcaggccccgggccgcggagggtgcagcgccgggcctggcct
cccgataaagaacaggaaaaagagaaaaaatcagtgatctgtgtcgagggcaatattgca
agtgggaagacgacatgcctggaattcttctccaacgcgacagacgtcgaggtgttaacg
gagcctgtgtccaagtggagaaatgtccgtggccacaatcctctgggcctgatgtaccac
gatgcctctcgctggggtcttacgctacagacttatgtgcagctcaccatgctggacagg
catactcgtcctcaggtgtcatctgtacggttgatggagaggtcgattcacagcgcaaga
tacatttttgtagaaaacctgtatagaagtgggaagatgccagaagtggactatgtagtt
ctgtcggaatggtttgactggatcttgaggaacatggacgtgtctgttgatttgatagtt
taccttcggaccaatcctgagacttgttaccagaggttaaagaagagatgcagggaagag
gagaaggtcattccgctggaatacctggaagcaattcaccatctccatgaggagtggctc
atcaaaggcagccttttccccatggcagcccctgttctggtgattgaggctgaccaccac
atggagaggatgttagaactctttgaacaaaatcgggatcgaatattaactccagagaat
cggaagcattgcccatag

DBGET integrated database retrieval system