KEGG   Homo sapiens (human): 7092
Entry
7092              CDS       T01001                                 

Gene name
TLL1, ASD6, TLL
Definition
(RefSeq) tolloid like 1
  KO
K09608  tolloid-like protein 1 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00546  Atrial septal defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7092 (TLL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     7092 (TLL1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   7092 (TLL1)
SSDB
Motif
Pfam: CUB Astacin FXa_inhibition EGF_CA cEGF EGF hEGF CUB_2 EGF_3 Peptidase_M10 Reprolysin_4
Other DBs
NCBI-GeneID: 7092
NCBI-ProteinID: NP_036596
OMIM: 606742
HGNC: 11843
Ensembl: ENSG00000038295
Vega: OTTHUMG00000161112
Pharos: O43897(Tbio)
UniProt: O43897 B7ZLW3
LinkDB
Structure
PDB: 
3EDI

Position
4q32.3
AA seq 1013 aa
MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFW
GDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGF
GLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCA
CEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHS
PSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDL
YSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAV
GLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK
NT seq 3042 nt   +upstreamnt  +downstreamnt
atggggttgggaacgctttccccgaggatgctcgtgtggctggtggcctcggggattgtt
ttctacggggagctatgggtctgcgctggcctcgattatgattacacttttgatgggaac
gaagaggataaaacagagactatagattacaaggacccgtgtaaagccgctgtattttgg
ggcgatattgccttagatgatgaagacttaaatatctttcaaatagataggacaattgac
cttacgcagaacccctttggaaaccttggacataccacaggtggacttggagaccatgct
atgtcaaagaagcgaggggccctctaccaacttatagacaggataagaagaattggcttt
ggcttggagcaaaacaacacagttaagggaaaagtacctctacaattctcagggcaaaat
gagaaaaatcgagttcccagagccgctacatcaagaacggaaagaatatggcctggaggc
gttattccttatgttataggaggaaacttcactggcagccagagagccatgttcaagcag
gccatgaggcactgggaaaagcacacatgtgtgactttcatagaaagaagtgatgaagag
agttacattgtattcacctataggccttgtggatgctgctcctatgtaggtcggcgagga
aatggacctcaggcaatctctatcggcaagaactgtgataaatttgggattgttgttcat
gaattgggtcatgtgataggcttttggcatgaacacacaagaccagatcgagataaccac
gtaactatcataagagaaaacatccagccaggtcaagagtacaattttctgaagatggag
cctggagaagtaaactcacttggagaaagatatgatttcgacagtatcatgcactatgcc
aggaacaccttctcaagggggatgtttctggataccattctcccctcccgtgatgataat
ggcatacgtcctgcaattggtcagcgaacccgtctaagcaaaggagatatcgcacaggca
agaaagctgtatagatgtccagcatgtggagaaactctacaagaatccaatggcaacctt
tcctctccaggatttcccaatggctacccttcttacacacactgcatctggagagtttct
gtgaccccaggggagaagattgttttaaattttacaacgatggatctatacaagagtagt
ttgtgctggtatgactatattgaagtaagagacgggtactggagaaaatcacctctcctt
ggtagattctgtggggacaaattgcctgaagttcttacttctacagacagcagaatgtgg
attgagtttcgtagcagcagtaattgggtaggaaaaggctttgcagctgtctatgaagcg
atctgtggaggtgagatacgtaaaaatgaaggacagattcagtctcccaattatcctgat
gactatcgcccgatgaaagaatgtgtgtggaaaataacagtgtctgagagctaccacgtc
gggctgacctttcagtcctttgagattgaaagacatgacaattgtgcttatgactacctg
gaagttagagatggaaccagtgaaaatagccctttgatagggcgtttctgtggttatgac
aaacctgaagacataagatctacctccaatactttgtggatgaagtttgtttctgacgga
actgtgaacaaagcagggtttgctgctaacttttttaaagaggaagatgagtgtgccaaa
cctgaccgtggaggctgtgagcagcgatgtctgaacactctgggcagttaccagtgtgcc
tgtgagcctggctatgagctgggcccagacagaaggagctgtgaagctgcttgtggtgga
cttcttaccaaacttaacggcaccataaccacccctggctggcccaaggagtaccctcct
aataagaactgtgtgtggcaagtggttgcaccaacccagtacagaatttctgtgaagttt
gagttttttgaattggaaggcaatgaagtttgcaaatatgattatgtggagatctggagt
ggtctttcctctgagtctaaactgcatggcaaattctgtggcgctgaagtgcctgaagtg
atcacatcccagttcaacaatatgagaattgaattcaaatctgacaatactgtatccaag
aagggcttcaaagcacattttttctcagacaaagatgaatgctctaaggataatggtgga
tgtcagcacgaatgtgtcaacacgatggggagctacatgtgtcaatgccgtaatggattt
gtgctacatgacaataaacatgattgcaaggaagctgagtgtgaacagaagatccacagt
ccaagtggcctcatcaccagtcccaactggccagacaagtacccaagcaggaaagaatgc
acttgggaaatcagcgccactcctggccaccgaatcaaattagcctttagtgaatttgag
attgagcagcatcaagaatgtgcttatgaccacttagaagtatttgatggagaaacagaa
aagtcaccgattcttggacgactgtgtggcaacaagataccagatccccttgtggctact
ggaaataaaatgtttgttcggtttgtttctgatgcatctgttcaaagaaaaggctttcaa
gctacacattctacagagtgtggcggacgattgaaagcagaatcaaaaccaagagatctg
tactcacatgctcagtttggtgataacaactacccaggacaggttgactgtgaatggcta
ttagtatcagaacggggctctcgacttgaattatccttccagacatttgaagtggaggaa
gaagcagactgtggctatgactatgtggagctctttgatggtcttgattcaacagctgtg
gggcttggtcgattctgtggatccgggccaccagaagagatttattcaattggagattca
gttttaattcatttccacactgatgacacaatcaacaagaagggatttcatataagatac
aaaagcataagatatccagataccacacataccaaaaaataa

DBGET integrated database retrieval system