KEGG   Homo sapiens (human): 7100Help
Entry
7100              CDS       T01001                                 

Gene name
TLR5, MELIOS, SLE1, SLEB1, TIL3
Definition
(RefSeq) toll like receptor 5
  KO
K10168  toll-like receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05321  Inflammatory bowel disease (IBD)
Disease
H00080  Systemic lupus erythematosus
Drug target
Entolimod: D10368
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7100 (TLR5)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    7100 (TLR5)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7100 (TLR5)
   05132 Salmonella infection
    7100 (TLR5)
   05134 Legionellosis
    7100 (TLR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    7100 (TLR5)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7100 (TLR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 LRR_5 LRR_9 TIR_2 LRR_1
Motif
Other DBs
NCBI-GeneID: 7100
NCBI-ProteinID: NP_003259
OMIM: 603031
HGNC: 11851
Ensembl: ENSG00000187554
Vega: OTTHUMG00000037937
Pharos: O60602(Tbio)
UniProt: O60602 A0A2R8Y7Z4
LinkDB All DBs
Structure
PDB: 

Position
1q41
AA seq 858 aa AA seqDB search
MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRT
VTASSFPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
LFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN
QIFLVCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV
DITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFV
FSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLP
KVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFL
GENMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTV
LSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVT
IAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEVLKSLKFSLFIVCTVTLTLFLMTILTV
TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYS
DQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCL
SDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDLQDVGWFLHKLSQQILKKE
KEKKKDNNIPLQTVATIS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccacctggaccttctcctaggagtggtgctcatggccggtcctgtgtttgga
attccttcctgctcctttgatggccgaatagccttttatcgtttctgcaacctcacccag
gtcccccaggtcctcaacaccactgagaggctcctgctgagcttcaactatatcaggaca
gtcactgcttcatccttcccctttctggaacagctgcagctgctggagctcgggagccag
tatacccccttgactattgacaaggaggccttcagaaacctgcccaaccttagaatcttg
gacctgggaagtagtaagatatacttcttgcatccagatgcttttcagggactgttccat
ctgtttgaacttagactgtatttctgtggtctctctgatgctgtattgaaagatggttat
ttcagaaatttaaaggctttaactcgcttggatctatccaaaaatcagattcgtagcctt
taccttcatccttcatttgggaagttgaattccttaaagtccatagatttttcctccaac
caaatattccttgtatgtgaacatgagctcgagcccctacaagggaaaacgctctccttt
tttagcctcgcagctaatagcttgtatagcagagtctcagtggactggggaaaatgtatg
aacccattcagaaacatggtgctggagatactagatgtttctggaaatggctggacagtg
gacatcacaggaaactttagcaatgccatcagcaaaagccaggccttctctttgattctt
gcccaccacatcatgggtgccgggtttggcttccataacatcaaagatcctgaccagaac
acatttgctggcctggccagaagttcagtgagacacctggatctttcacatgggtttgtc
ttctccctgaactcacgagtctttgagacactcaaggatttgaaggttctgaaccttgcc
tacaacaagataaataagattgcagatgaagcattttacggacttgacaacctccaagtt
ctcaatttgtcatataaccttctgggggaactttacagttcgaatttctatggactacct
aaggtagcctacattgatttgcaaaagaatcacattgcaataattcaagaccaaacattc
aaattcctggaaaaattacagaccttggatctccgagacaatgctcttacaaccattcat
tttattccaagcatacccgatatcttcttgagtggcaataaactagtgactttgccaaag
atcaaccttacagcgaacctcatccacttatcagaaaacaggctagaaaatctagatatt
ctctactttctcctacgggtacctcatctccagattctcattttaaatcaaaatcgcttc
tcctcctgtagtggagatcaaaccccttcagagaatcccagcttagaacagcttttcctt
ggagaaaatatgttgcaacttgcctgggaaactgagctctgttgggatgtttttgaggga
ctttctcatcttcaagttctgtatttgaatcataactatcttaattcccttccaccagga
gtatttagccatctgactgcattaaggggactaagcctcaactccaacaggctgacagtt
ctttctcacaatgatttacctgctaatttagagatcctggacatatccaggaaccagctc
ctagctcctaatcctgatgtatttgtatcacttagtgtcttggatataactcataacaag
ttcatttgtgaatgtgaacttagcacttttatcaattggcttaatcacaccaatgtcact
atagctgggcctcctgcagacatatattgtgtgtaccctgactcgttctctggggtttcc
ctcttctctctttccacggaaggttgtgatgaagaggaagtcttaaagtccctaaagttc
tcccttttcattgtatgcactgtcactctgactctgttcctcatgaccatcctcacagtc
acaaagttccggggcttctgttttatctgttataagacagcccagagactggtgttcaag
gaccatccccagggcacagaacctgatatgtacaaatatgatgcctatttgtgcttcagc
agcaaagacttcacatgggtgcagaatgctttgctcaaacacctggacactcaatacagt
gaccaaaacagattcaacctgtgctttgaagaaagagactttgtcccaggagaaaaccgc
attgccaatatccaggatgccatctggaacagtagaaagatcgtttgtcttgtgagcaga
cacttccttagagatggctggtgccttgaagccttcagttatgcccagggcaggtgctta
tctgaccttaacagtgctctcatcatggtggtggttgggtccttgtcccagtaccagttg
atgaaacatcaatccatcagaggctttgtacagaaacagcagtatttgaggtggcctgag
gatctccaggatgttggctggtttcttcataaactctctcaacagatactaaagaaagaa
aaagaaaagaagaaagacaataacattccgttgcaaactgtagcaaccatctcctaa

DBGET integrated database retrieval system