KEGG   Homo sapiens (human): 7113Help
Entry
7113              CDS       T01001                                 

Gene name
TMPRSS2, PP9284, PRSS10
Definition
(RefSeq) transmembrane serine protease 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    7113 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    7113 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    7113 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    7113 (TMPRSS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     7113 (TMPRSS2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   7113 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 7113
NCBI-ProteinID: NP_005647
OMIM: 602060
HGNC: 11876
Ensembl: ENSG00000184012
Vega: OTTHUMG00000086762
Pharos: O15393(Tchem)
UniProt: O15393
LinkDB All DBs
Position
21q22.3
AA seq 492 aa AA seqDB search
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIEC
DSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVF
TDWIYRQMRADG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccaccagctattggaccttactatgaaaaccatggatac
caaccggaaaacccctatcccgcacagcccactgtggtccccactgtctacgaggtgcat
ccggctcagtactacccgtcccccgtgccccagtacgccccgagggtcctgacgcaggct
tccaaccccgtcgtctgcacgcagcccaaatccccatccgggacagtgtgcacctcaaag
actaagaaagcactgtgcatcaccttgaccctggggaccttcctcgtgggagctgcgctg
gccgctggcctactctggaagttcatgggcagcaagtgctccaactctgggatagagtgc
gactcctcaggtacctgcatcaacccctctaactggtgtgatggcgtgtcacactgcccc
ggcggggaggacgagaatcggtgtgttcgcctctacggaccaaacttcatccttcaggtg
tactcatctcagaggaagtcctggcaccctgtgtgccaagacgactggaacgagaactac
gggcgggcggcctgcagggacatgggctataagaataatttttactctagccaaggaata
gtggatgacagcggatccaccagctttatgaaactgaacacaagtgccggcaatgtcgat
atctataaaaaactgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgc
tgtatagcctgcggggtcaacttgaactcaagccgccagagcaggattgtgggcggcgag
agcgcgctcccgggggcctggccctggcaggtcagcctgcacgtccagaacgtccacgtg
tgcggaggctccatcatcacccccgagtggatcgtgacagccgcccactgcgtggaaaaa
cctcttaacaatccatggcattggacggcatttgcggggattttgagacaatctttcatg
ttctatggagccggataccaagtagaaaaagtgatttctcatccaaattatgactccaag
accaagaacaatgacattgcgctgatgaagctgcagaagcctctgactttcaacgaccta
gtgaaaccagtgtgtctgcccaacccaggcatgatgctgcagccagaacagctctgctgg
atttccgggtggggggccaccgaggagaaagggaagacctcagaagtgctgaacgctgcc
aaggtgcttctcattgagacacagagatgcaacagcagatatgtctatgacaacctgatc
acaccagccatgatctgtgccggcttcctgcaggggaacgtcgattcttgccagggtgac
agtggagggcctctggtcacttcgaagaacaatatctggtggctgataggggatacaagc
tggggttctggctgtgccaaagcttacagaccaggagtgtacgggaatgtgatggtattc
acggactggatttatcgacaaatgagggcagacggctaa

DBGET integrated database retrieval system