KEGG   Homo sapiens (human): 7124Help
Entry
7124              CDS       T01001                                 

Gene name
TNF, DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04612  Antigen processing and presentation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04940  Type I diabetes mellitus
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05310  Asthma
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06131  Apoptosis (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06223  TNF-NFKB signaling
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
  Element
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00374  TNF-IRF1 signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00468  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00860  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00861  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00083  Allograft rejection
H00084  Graft-versus-host disease
Drug target
Adalimumab: D02597
Afelimomab: D07436
Certolizumab pegol: D03441
Etanercept: D00742
Golimumab: D04358
Infliximab: D02598
Lenalidomide (DG00744): D04687 D09813
Lenercept: D04690
Nerelimomab: D05146
Onercept: D05263
Ozoralizumab: D09944
Pegsunercept: D05393
Pirfenidone: D01583
Placulumab: D10320
Pomalidomide: D08976
Thalidomide: D00754
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7124 (TNF)
   04350 TGF-beta signaling pathway
    7124 (TNF)
   04064 NF-kappa B signaling pathway
    7124 (TNF)
   04668 TNF signaling pathway
    7124 (TNF)
   04071 Sphingolipid signaling pathway
    7124 (TNF)
   04150 mTOR signaling pathway
    7124 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7124 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    7124 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7124 (TNF)
   04217 Necroptosis
    7124 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7124 (TNF)
   04620 Toll-like receptor signaling pathway
    7124 (TNF)
   04621 NOD-like receptor signaling pathway
    7124 (TNF)
   04622 RIG-I-like receptor signaling pathway
    7124 (TNF)
   04625 C-type lectin receptor signaling pathway
    7124 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    7124 (TNF)
   04612 Antigen processing and presentation
    7124 (TNF)
   04660 T cell receptor signaling pathway
    7124 (TNF)
   04657 IL-17 signaling pathway
    7124 (TNF)
   04664 Fc epsilon RI signaling pathway
    7124 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7124 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7124 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    7124 (TNF)
  09163 Immune disease
   05310 Asthma
    7124 (TNF)
   05322 Systemic lupus erythematosus
    7124 (TNF)
   05323 Rheumatoid arthritis
    7124 (TNF)
   05321 Inflammatory bowel disease (IBD)
    7124 (TNF)
   05330 Allograft rejection
    7124 (TNF)
   05332 Graft-versus-host disease
    7124 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7124 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    7124 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7124 (TNF)
   05410 Hypertrophic cardiomyopathy (HCM)
    7124 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    7124 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    7124 (TNF)
   04940 Type I diabetes mellitus
    7124 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7124 (TNF)
   04931 Insulin resistance
    7124 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7124 (TNF)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7124 (TNF)
   05132 Salmonella infection
    7124 (TNF)
   05131 Shigellosis
    7124 (TNF)
   05135 Yersinia infection
    7124 (TNF)
   05133 Pertussis
    7124 (TNF)
   05134 Legionellosis
    7124 (TNF)
   05152 Tuberculosis
    7124 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7124 (TNF)
   05170 Human immunodeficiency virus 1 infection
    7124 (TNF)
   05164 Influenza A
    7124 (TNF)
   05161 Hepatitis B
    7124 (TNF)
   05160 Hepatitis C
    7124 (TNF)
   05168 Herpes simplex virus 1 infection
    7124 (TNF)
   05163 Human cytomegalovirus infection
    7124 (TNF)
   05169 Epstein-Barr virus infection
    7124 (TNF)
   05165 Human papillomavirus infection
    7124 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7124 (TNF)
   05144 Malaria
    7124 (TNF)
   05145 Toxoplasmosis
    7124 (TNF)
   05140 Leishmaniasis
    7124 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    7124 (TNF)
   05143 African trypanosomiasis
    7124 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    7124 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7124 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7124 (TNF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   7124 (TNF)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Cytokines
   7124 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 7124
NCBI-ProteinID: NP_000585
OMIM: 191160
HGNC: 11892
Ensembl: ENSG00000232810
Vega: OTTHUMG00000031194
Pharos: P01375(Tclin)
UniProt: P01375 Q5STB3
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 233 aa AA seqDB search
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

KEGG   Homo sapiens (human): 3569Help
Entry
3569              CDS       T01001                                 

Gene name
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01523  Antifolate resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05020  Prion diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
Network
nt06110  MAPK signaling (viruses)
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00468  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00860  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00861  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Disease
H00084  Graft-versus-host disease
H01479  Castleman disease
H01672  Juvenile idiopathic arthritis
Drug target
Pirfenidone: D01583
Pomalidomide: D08976
Siltuximab: D09669
Sirukumab: D10080
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3569 (IL6)
   04668 TNF signaling pathway
    3569 (IL6)
   04066 HIF-1 signaling pathway
    3569 (IL6)
   04068 FoxO signaling pathway
    3569 (IL6)
   04151 PI3K-Akt signaling pathway
    3569 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3569 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3569 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3569 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3569 (IL6)
   04620 Toll-like receptor signaling pathway
    3569 (IL6)
   04621 NOD-like receptor signaling pathway
    3569 (IL6)
   04623 Cytosolic DNA-sensing pathway
    3569 (IL6)
   04625 C-type lectin receptor signaling pathway
    3569 (IL6)
   04659 Th17 cell differentiation
    3569 (IL6)
   04657 IL-17 signaling pathway
    3569 (IL6)
   04672 Intestinal immune network for IgA production
    3569 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3569 (IL6)
   05202 Transcriptional misregulation in cancer
    3569 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3569 (IL6)
   05321 Inflammatory bowel disease (IBD)
    3569 (IL6)
   05332 Graft-versus-host disease
    3569 (IL6)
  09164 Neurodegenerative disease
   05020 Prion diseases
    3569 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3569 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3569 (IL6)
   04931 Insulin resistance
    3569 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3569 (IL6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3569 (IL6)
   05132 Salmonella infection
    3569 (IL6)
   05135 Yersinia infection
    3569 (IL6)
   05133 Pertussis
    3569 (IL6)
   05134 Legionellosis
    3569 (IL6)
   05152 Tuberculosis
    3569 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3569 (IL6)
   05162 Measles
    3569 (IL6)
   05164 Influenza A
    3569 (IL6)
   05161 Hepatitis B
    3569 (IL6)
   05168 Herpes simplex virus 1 infection
    3569 (IL6)
   05163 Human cytomegalovirus infection
    3569 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3569 (IL6)
   05169 Epstein-Barr virus infection
    3569 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3569 (IL6)
   05144 Malaria
    3569 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    3569 (IL6)
   05143 African trypanosomiasis
    3569 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3569 (IL6)
   01523 Antifolate resistance
    3569 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3569 (IL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3569 (IL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF BTHB
Motif
Other DBs
NCBI-GeneID: 3569
NCBI-ProteinID: NP_000591
OMIM: 147620
HGNC: 6018
Ensembl: ENSG00000136244
Vega: OTTHUMG00000023178
Pharos: P05231(Tclin)
UniProt: P05231 Q75MH2 B4DVM1
LinkDB All DBs
Structure
PDB: 

Position
7p15.3
AA seq 212 aa AA seqDB search
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

KEGG   Homo sapiens (human): 3592Help
Entry
3592              CDS       T01001                                 

Gene name
IL12A, CLMF, IL-12A, NFSK, NKSF1, P35
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00435  TLR2/4-NFKB signaling pathway
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3592 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3592 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3592 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    3592 (IL12A)
   04625 C-type lectin receptor signaling pathway
    3592 (IL12A)
   04658 Th1 and Th2 cell differentiation
    3592 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3592 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3592 (IL12A)
   05330 Allograft rejection
    3592 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3592 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3592 (IL12A)
   05134 Legionellosis
    3592 (IL12A)
   05152 Tuberculosis
    3592 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    3592 (IL12A)
   05164 Influenza A
    3592 (IL12A)
   05168 Herpes simplex virus 1 infection
    3592 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3592 (IL12A)
   05144 Malaria
    3592 (IL12A)
   05145 Toxoplasmosis
    3592 (IL12A)
   05140 Leishmaniasis
    3592 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    3592 (IL12A)
   05143 African trypanosomiasis
    3592 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3592 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3592 (IL12A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3592 (IL12A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Cytokines
   3592 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12
Motif
Other DBs
NCBI-GeneID: 3592
NCBI-ProteinID: NP_000873
OMIM: 161560
HGNC: 5969
Ensembl: ENSG00000168811
Vega: OTTHUMG00000158942
Pharos: P29459(Tclin)
UniProt: P29459 O60595
LinkDB All DBs
Structure
PDB: 

Position
3q25.33
AA seq 253 aa AA seqDB search
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgccctgtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctcccc
gtggccactccagacccaggaatgttcccatgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

KEGG   Homo sapiens (human): 3593Help
Entry
3593              CDS       T01001                                 

Gene name
IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00435  TLR2/4-NFKB signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3593 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3593 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3593 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    3593 (IL12B)
   04625 C-type lectin receptor signaling pathway
    3593 (IL12B)
   04658 Th1 and Th2 cell differentiation
    3593 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3593 (IL12B)
   05205 Proteoglycans in cancer
    3593 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3593 (IL12B)
   05330 Allograft rejection
    3593 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3593 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3593 (IL12B)
   05134 Legionellosis
    3593 (IL12B)
   05152 Tuberculosis
    3593 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    3593 (IL12B)
   05164 Influenza A
    3593 (IL12B)
   05168 Herpes simplex virus 1 infection
    3593 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3593 (IL12B)
   05145 Toxoplasmosis
    3593 (IL12B)
   05140 Leishmaniasis
    3593 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    3593 (IL12B)
   05143 African trypanosomiasis
    3593 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3593 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3593 (IL12B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3593 (IL12B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Cytokines
   3593 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 fn3 Ig_4 I-set
Motif
Other DBs
NCBI-GeneID: 3593
NCBI-ProteinID: NP_002178
OMIM: 161561
HGNC: 5970
Ensembl: ENSG00000113302
Vega: OTTHUMG00000130307
Pharos: P29460(Tclin)
UniProt: P29460
LinkDB All DBs
Structure
PDB: 

Position
5q33.3
AA seq 328 aa AA seqDB search
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggttctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagagtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gctgctgaggagagtctgcccattgaggtcatggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtcttcacggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcattagcgtgcgggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system