KEGG   Homo sapiens (human): 7125
Entry
7125              CDS       T01001                                 

Gene name
TNNC2, CFAP85, FAP85
Definition
(RefSeq) troponin C2, fast skeletal type
  KO
K12042  troponin C, skeletal muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Drug target
Reldesemtiv: D11363
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7125 (TNNC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7125 (TNNC2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7125 (TNNC2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF1456 TerB DUF5580 p25-alpha RTX_C SurA_N_2 DUF533
Other DBs
NCBI-GeneID: 7125
NCBI-ProteinID: NP_003270
OMIM: 191039
HGNC: 11944
Ensembl: ENSG00000101470
Vega: OTTHUMG00000032623
Pharos: P02585(Tbio)
UniProt: P02585
LinkDB
Position
20q13.12
AA seq 160 aa
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacggaccagcaggctgaggccaggtcctacctcagcgaagagatgatcgctgagttc
aaggctgcctttgacatgtttgatgctgatggtggtggggacatcagcgtcaaggagttg
ggcacggtgatgaggatgctgggccagacacccaccaaggaggagctggacgccatcatc
gaggaggtggatgaggacggcagcggcaccatcgacttcgaggagttcttggtcatgatg
gtgcgccagatgaaagaggacgcgaaagggaagagcgaggaggagctggccgagtgcttc
cgcatcttcgacaggaatgcagacggctacatcgacccggaggagctggctgagattttc
agggcctccggggagcacgtgacggacgaggagatcgaatctctgatgaaagacggcgac
aagaacaacgacggccgcattgacttcgacgagttcctgaagatgatggagggcgtgcag
taa

KEGG   Homo sapiens (human): 7134
Entry
7134              CDS       T01001                                 

Gene name
TNNC1, CMD1Z, CMH13, TN-C, TNC, TNNC
Definition
(RefSeq) troponin C1, slow skeletal and cardiac type
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7134 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7134 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    7134 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    7134 (TNNC1)
   05414 Dilated cardiomyopathy
    7134 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7134 (TNNC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7134 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580 EMG1 EF-hand_10 Dak2
Other DBs
NCBI-GeneID: 7134
NCBI-ProteinID: NP_003271
OMIM: 191040
HGNC: 11943
Ensembl: ENSG00000114854
Vega: OTTHUMG00000158572
Pharos: P63316(Tclin)
UniProt: P63316 Q6FH91
LinkDB
Structure
PDB: 

Position
3p21.1
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagccttcgacatcttcgtgctgggcgctgaggatggctgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacccctgaggagctgcaggagatg
atcgatgaggtggacgaggacggcagcggcacggtggactttgatgagttcctggtcatg
atggttcggtgcatgaaggacgacagcaaagggaaatctgaggaggagctgtctgacctc
ttccgcatgtttgacaaaaatgctgatggctacatcgacctggatgagctgaagataatg
ctgcaggctacaggcgagaccatcacggaggacgacatcgaggagctcatgaaggacgga
gacaagaacaacgacggccgcatcgactatgatgagttcctggagttcatgaagggtgtg
gagtag

DBGET integrated database retrieval system