KEGG   Homo sapiens (human): 7137Help
Entry
7137              CDS       T01001                                 

Gene name
TNNI3, CMD1FF, CMD2A, CMH7, RCM1, TNNC1, cTnI
Definition
(RefSeq) troponin I3, cardiac type
  KO
K12044  troponin I, cardiac muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
H01219  Restrictive cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7137 (TNNI3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7137 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    7137 (TNNI3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    7137 (TNNI3)
   05414 Dilated cardiomyopathy (DCM)
    7137 (TNNI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7137 (TNNI3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7137 (TNNI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin Troponin-I_N Tup_N DUF919 DUF3738
Motif
Other DBs
NCBI-GeneID: 7137
NCBI-ProteinID: NP_000354
OMIM: 191044
HGNC: 11947
Ensembl: ENSG00000129991
Vega: OTTHUMG00000180589
Pharos: P19429(Tbio)
UniProt: P19429 Q6FGX2
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 210 aa AA seqDB search
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE
LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK
NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED
TEKENREVGDWRKNIDALSGMEGRKKKFES
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgggagcagcgatgcggctagggaacctcgccctgcaccagccccaatcaga
cgccgctcctccaactaccgcgcttatgccacggagccgcacgccaagaaaaaatctaag
atctccgcctcgagaaaattgcagctgaagactctgctgctgcagattgcaaagcaagag
ctggagcgagaggcggaggagcggcgcggagagaaggggcgcgctctgagcacccgctgc
cagccgctggagttggccgggctgggcttcgcggagctgcaggacttgtgccgacagctc
cacgcccgtgtggacaaggtggatgaagagagatacgacatagaggcaaaagtcaccaag
aacatcacggagattgcagatctgactcagaagatctttgaccttcgaggcaagtttaag
cggcccaccctgcggagagtgaggatctctgcagatgccatgatgcaggcgctgctgggg
gcccgggctaaggagtccctggacctgcgggcccacctcaagcaggtgaagaaggaggac
accgagaaggaaaaccgggaggtgggagactggcgcaagaacatcgatgcactgagtgga
atggagggccgcaagaaaaagtttgagagctga

DBGET integrated database retrieval system