KEGG   Homo sapiens (human): 717
Entry
717               CDS       T01001                                 

Gene name
C2, ARMD14, CO2
Definition
(RefSeq) complement C2
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00080  Systemic lupus erythematosus
H00102  Classic complement pathway component defects
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    717 (C2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    717 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    717 (C2)
   05150 Staphylococcus aureus infection
    717 (C2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    717 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    717 (C2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     717 (C2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   717 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 DUF1986 HRM Trypsin_2
Other DBs
NCBI-GeneID: 717
NCBI-ProteinID: NP_000054
OMIM: 613927
HGNC: 1248
Ensembl: ENSG00000166278
Vega: OTTHUMG00000031190
Pharos: P06681(Tbio)
UniProt: P06681 Q5JP69 Q53HP3
LinkDB
Structure
PDB: 
3ERB 2ODP 2I6Q 2ODQ 2I6S

Position
6p21.33
AA seq 752 aa
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGME
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgggcccactgatggttcttttttgcctgctgttcctgtacccaggtctggcagactcg
gctccctcctgccctcagaacgtgaatatctcgggtggcaccttcaccctcagccatggc
tgggctcctgggagccttctcacctactcctgcccccagggcctgtacccatccccagca
tcacggctgtgcaagagcagcggacagtggcagaccccaggagccacccggtctctgtct
aaggcggtctgcaaacctgtgcgctgtccagcccctgtctcctttgagaatggcatttat
accccacggctggggtcctatcccgtgggtggcaatgtgagcttcgagtgtgaggatggc
ttcatattgcggggctcgcctgtgcgtcagtgtcgccccaacggcatgtgggatggagaa
acagctgtgtgtgataatggggctggccactgccccaacccaggcatttcactgggcgca
gtgcggacaggcttccgctttggtcatggggacaaggtccgctatcgctgctcctcgaat
cttgtgctcacggggtcttcggagcgggagtgccagggcaacggggtctggagtggaacg
gagcccatctgccgccaaccctactcttatgacttccctgaggacgtggcccctgccctg
ggcacttccttctcccacatgcttggggccaccaatcccacccagaagacaaaggaaagc
ctgggccgtaaaatccaaatccagcgctctggtcatctgaacctctacctgctcctggac
tgttcgcagagtgtgtcggaaaatgactttctcatcttcaaggagagcgcctccctcatg
gtggacaggatcttcagctttgagatcaatgtgagcgttgccattatcacctttgcctca
gagcccaaagtcctcatgtctgtcctgaacgacaactcccgggatatgactgaggtgatc
agcagcctggaaaatgccaactataaagatcatgaaaatggaactgggactaacacctat
gcggccttaaacagtgtctatctcatgatgaacaaccaaatgcgactcctcggcatggaa
acgatggcctggcaggaaatccgacatgccatcatccttctgacagatggaaagtccaat
atgggtggctctcccaagacagctgttgaccatatcagagagatcctgaacatcaaccag
aagaggaatgactatctggacatctatgccatcggggtgggcaagctggatgtggactgg
agagaactgaatgagctagggtccaagaaggatggtgagaggcatgccttcattctgcag
gacacaaaggctctgcaccaggtctttgaacatatgctggatgtctccaagctcacagac
accatctgcggggtggggaacatgtcagcaaacgcctctgaccaggagaggacaccctgg
catgtcactattaagcccaagagccaagagacctgccggggggccctcatctccgaccaa
tgggtcctgacagcagctcattgcttccgcgatggcaacgaccactccctgtggagggtc
aatgtgggagaccccaaatcccagtggggcaaagaattccttattgagaaggcggtgatc
tccccagggtttgatgtctttgccaaaaagaaccagggaatcctggagttctatggtgat
gacatagctctgctgaagctggcccagaaagtaaagatgtccacccatgccaggcccatc
tgccttccctgcacgatggaggccaatctggctctgcggagacctcaaggcagcacctgt
agggaccatgagaatgaactgctgaacaaacagagtgttcctgctcattttgtcgccttg
aatgggagcaaactgaacattaaccttaagatgggagtggagtggacaagctgtgccgag
gttgtctcccaagaaaaaaccatgttccccaacttgacagatgtcagggaggtggtgaca
gaccagttcctatgcagtgggacccaggaggatgagagtccctgcaagggagaatctggg
ggagcagttttccttgagcggagattcaggttttttcaggtgggtctggtgagctggggt
ctttacaacccctgccttggctctgctgacaaaaactcccgcaaaagggcccctcgtagc
aaggtcccgccgccacgagactttcacatcaatctcttccgcatgcagccctggctgagg
cagcacctgggggatgtcctgaattttttacccctctag

DBGET integrated database retrieval system