KEGG   Homo sapiens (human): 7173
Entry
7173              CDS       T01001                                 

Gene name
TPO, MSA, TDH2A, TPX
Definition
(RefSeq) thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05320  Autoimmune thyroid disease
Module
hsa_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Network
nt06322  TRH-TSH-TH signaling
  Element
N00789  Mutation-inactivated TPO to iodide organification/coupling reactions
N00790  Mutation-inactivated TG to iodide organification/coupling reactions
N00803  Iodide organification/coupling reactions
Disease
H00251  Thyroid dyshormonogenesis
Drug target
Benzylthiouracil: D07519
Carbimazole: D07616
Methylthiouracil: D07231
Propylthiouracil: D00562<JP/US>
Thiamazole: D00401<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    7173 (TPO)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    7173 (TPO)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    7173 (TPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     7173 (TPO)
SSDB
Motif
Pfam: An_peroxidase EGF_CA Sushi EGF_3 cEGF FXa_inhibition EGF LRRNT
Other DBs
NCBI-GeneID: 7173
NCBI-ProteinID: NP_000538
OMIM: 606765
HGNC: 12015
Ensembl: ENSG00000115705
Vega: OTTHUMG00000090271
Pharos: P07202(Tclin)
UniProt: P07202 Q502Y3 Q6P534
LinkDB
Position
2p25.3
AA seq 933 aa
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES
CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgagagcgctcgctgtgctgtctgtcacgctggttatggcctgcacagaagccttcttc
cccttcatctcgagagggaaagaactcctttggggaaagcctgaggagtctcgtgtctct
agcgtcttggaggaaagcaagcgcctggtggacaccgccatgtacgccacgatgcagaga
aacctcaagaaaagaggaatcctttctccagctcagcttctgtctttttccaaacttcct
gagccaacaagcggagtgattgcccgagcagcagagataatggaaacatcaatacaagcg
atgaaaagaaaagtcaacctgaaaactcaacaatcacagcatccaacggatgctttatca
gaagatctgctgagcatcattgcaaacatgtctggatgtctcccttacatgctgccccca
aaatgcccaaacacttgcctggcgaacaaatacaggcccatcacaggagcttgcaacaac
agagaccaccccagatggggcgcctccaacacggccctggcacgatggctccctccagtc
tatgaggacggcttcagtcagccccgaggctggaaccccggcttcttgtacaacgggttc
ccactgcccccggtccgggaggtgacaagacatgtcattcaagtttcaaatgaggttgtc
acagatgatgaccgctattctgacctcctgatggcatggggacaatacatcgaccacgac
atcgcgttcacaccacagagcaccagcaaagctgccttcgggggaggggctgactgccag
atgacttgtgagaaccaaaacccatgttttcccatacaactcccggaggaggcccggccg
gccgcgggcaccgcctgtctgcccttctaccgctcttcggccgcctgcggcaccggggac
caaggcgcgctctttgggaacctgtccacggccaacccgcggcagcagatgaacgggttg
acctcgttcctggacgcgtccaccgtgtatggcagctccccggccctagagaggcagctg
cggaactggaccagtgccgaagggctgctccgcgtccacgcgcgcctccgggactccggc
cgcgcctacctgcccttcgtgccgccacgcgcgcctgcggcctgtgcgcccgagcccggc
atccccggagagacccgcgggccctgcttcctggccggagacggccgcgccagcgaggtc
ccctccctgacggcactgcacacgctgtggctgcgcgagcacaaccgcctggccgcggcg
ctcaaggccctcaatgcgcactggagcgcggacgccgtgtaccaggaggcgcgcaaggtc
gtgggcgctctgcaccagatcatcaccctgagggattacatccccaggatcctgggaccc
gaggccttccagcagtacgtgggtccctatgaaggctatgactccaccgccaaccccact
gtgtccaacgtgttctccacagccgccttccgcttcggccatgccacgatccacccgctg
gtgaggaggctggacgccagcttccaggagcaccccgacctgcccgggctgtggctgcac
caggctttcttcagcccatggacattactccgtggaggtggtttggacccactaatacga
ggccttcttgcaagaccagccaaactgcaggtgcaggatcagctgatgaacgaggagctg
acggaaaggctctttgtgctgtccaattccagcaccttggatctggcgtccatcaacctg
cagaggggccgggaccacgggctgccaggttacaatgagtggagggagttctgcggcctg
cctcgcctggagacccccgctgacctgagcacagccatcgccagcaggagcgtggccgac
aagatcctggacttgtacaagcatcctgacaacatcgatgtctggctgggaggcttagct
gaaaacttcctccccagggctcggacagggcccctgtttgcctgtctcattgggaagcag
atgaaggctctgcgggacggtgactggttttggtgggagaacagccacgtcttcacggat
gcacagaggcgtgagctggagaagcactccctgtctcgggtcatctgtgacaacactggc
ctcaccagggtgcccatggatgccttccaagtcggcaaattccccgaagactttgagtct
tgtgacagcatcactggcatgaacctggaggcctggagggaaacctttcctcaagacgac
aagtgtggcttcccagagagcgtggagaatggggactttgtgcactgtgaggagtctggg
aggcgcgtgctggtgtattcctgccggcacgggtatgagctccaaggccgggagcagctc
acttgcacccaggaaggatgggatttccagcctcccctctgcaaagatgtgaacgagtgt
gcagacggtgcccaccccccctgccacgcctctgcgaggtgcagaaacaccaaaggcggc
ttccagtgtctctgcgcggacccctacgagttaggagacgatgggagaacctgcgtagac
tccgggaggctccctcgggtgacttggatctccatgtcgctggctgctctgctgatcgga
ggcttcgcaggtctcacctcgacggtgatttgcaggtggacacgcactggcactaaatcc
acactgcccatctcggagacaggcggaggaactcccgagctgagatgcggaaagcaccag
gccgtagggacctcaccgcagcgggccgcagctcaggactcggagcaggagagtgctggg
atggaaggccgggatactcacaggctgccgagagccctctga

DBGET integrated database retrieval system