KEGG   Homo sapiens (human): 7186
Entry
7186              CDS       T01001                                 

Gene name
TRAF2, MGC:45012, RNF117, TRAP, TRAP3
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06412  Unfolded protein response (UPR) signaling
nt06416  TNF signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00505  CD40-NFKB signaling pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00928  Escherichia NleB to TNF-NFKB signaling pathway
N00944  Shigella OspI to TNF-NFKB signaling pathway
N01013  IRE1a-JNK signaling pathway
N01113  Salmonella SseK1 to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7186 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7186 (TRAF2)
   04064 NF-kappa B signaling pathway
    7186 (TRAF2)
   04668 TNF signaling pathway
    7186 (TRAF2)
   04071 Sphingolipid signaling pathway
    7186 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7186 (TRAF2)
   04217 Necroptosis
    7186 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7186 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    7186 (TRAF2)
   04657 IL-17 signaling pathway
    7186 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7186 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7186 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7186 (TRAF2)
   05203 Viral carcinogenesis
    7186 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7186 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7186 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    7186 (TRAF2)
   05016 Huntington disease
    7186 (TRAF2)
   05017 Spinocerebellar ataxia
    7186 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    7186 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7186 (TRAF2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7186 (TRAF2)
   05132 Salmonella infection
    7186 (TRAF2)
   05131 Shigellosis
    7186 (TRAF2)
   05135 Yersinia infection
    7186 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7186 (TRAF2)
   05160 Hepatitis C
    7186 (TRAF2)
   05168 Herpes simplex virus 1 infection
    7186 (TRAF2)
   05163 Human cytomegalovirus infection
    7186 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7186 (TRAF2)
   05169 Epstein-Barr virus infection
    7186 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7186 (TRAF2)
   04121 Ubiquitin system [BR:hsa04121]
    7186 (TRAF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7186 (TRAF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     7186 (TRAF2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7186 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH SlyX
Other DBs
NCBI-GeneID: 7186
NCBI-ProteinID: NP_066961
OMIM: 601895
HGNC: 12032
Ensembl: ENSG00000127191
Vega: OTTHUMG00000020952
Pharos: Q12933(Tbio)
UniProt: Q12933 A0A024R8H5
LinkDB
Structure
PDB: 

Position
9q34.3
AA seq 501 aa
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccctggagttgctacagcccggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcagaaacgtc
ctccgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggccttcccagataatgctgcccgcagggaggtg
gagagcctgccggccgtctgtcccagtgatggatgcacctggaaggggaccctgaaagaa
tacgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgtcccgcgtgcaaa
ggcctggtccgccttggtgaaaaggagcgccacctggagcacgagtgcccggagagaagc
ctgagctgccggcattgccgggcaccctgctgcggagcagacgtgaaggcgcaccacgag
gtctgccccaagttccccttaacttgtgacggctgcggcaagaagaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgagtcccttgcagattccacgcc
atcggctgcctcgagacggtagagggtgagaaacagcaggagcacgaggtgcagtggctg
cgggagcacctggccatgctactgagctcggtgctggaggcaaagcccctcttgggagac
cagagccacgcggggtcagagctcctgcagaggtgcgagagcctggagaagaagacggcc
acttttgagaacattgtctgcgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtagcaag
gtgcagcagctggagaggagcattggcctcaaggacctggcgatggctgacttggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggctggccgcatacccgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgtatctacctgaacggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgctcgaccagaataaccgg
gagcacgtgattgacgccttcaggcccgacgtgacttcatcctcttttcagaggccagtc
aacgacatgaacatcgcaagcggctgccccctcttctgccccgtctccaagatggaggca
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

KEGG   Homo sapiens (human): 7189
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
   04140 Autophagy - animal
    7189 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
   04657 IL-17 signaling pathway
    7189 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7189 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7189 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    7189 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7189 (TRAF6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7189 (TRAF6)
   05132 Salmonella infection
    7189 (TRAF6)
   05131 Shigellosis
    7189 (TRAF6)
   05135 Yersinia infection
    7189 (TRAF6)
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05161 Hepatitis B
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex virus 1 infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease
    7189 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7189 (TRAF6)
   04121 Ubiquitin system [BR:hsa04121]
    7189 (TRAF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7189 (TRAF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    7189 (TRAF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7189 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX zf-RING_11 U-box Tropomyosin_1 Spc29 ADIP Dynactin_p22 DM EzrA DUF16 UPF0242 FliJ AAA_13 CENP-F_leu_zip DUF3450 Filament Sina Lebercilin PspA_IM30
Other DBs
NCBI-GeneID: 7189
NCBI-ProteinID: NP_004611
OMIM: 602355
HGNC: 12036
Ensembl: ENSG00000175104
Vega: OTTHUMG00000166391
Pharos: Q9Y4K3(Tbio)
UniProt: Q9Y4K3
LinkDB
Structure
PDB: 

Position
11p12
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

DBGET integrated database retrieval system