KEGG   Homo sapiens (human): 7187Help
Entry
7187              CDS       T01001                                 

Gene name
TRAF3, CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1, RNF118
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06114  PI3K signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06133  RIG-I signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00505  CD40-NFKB signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
N00728  IAV NS1 to RIG-I-like receptor signaling pathway
N00732  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7187 (TRAF3)
   04668 TNF signaling pathway
    7187 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7187 (TRAF3)
   04621 NOD-like receptor signaling pathway
    7187 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    7187 (TRAF3)
   04657 IL-17 signaling pathway
    7187 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7187 (TRAF3)
   05203 Viral carcinogenesis
    7187 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7187 (TRAF3)
  09172 Infectious disease: viral
   05162 Measles
    7187 (TRAF3)
   05164 Influenza A
    7187 (TRAF3)
   05161 Hepatitis B
    7187 (TRAF3)
   05160 Hepatitis C
    7187 (TRAF3)
   05168 Herpes simplex virus 1 infection
    7187 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7187 (TRAF3)
   05169 Epstein-Barr virus infection
    7187 (TRAF3)
   05165 Human papillomavirus infection
    7187 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF ATG16 MPS2 zf-C3HC4 Spc7 Tropomyosin_1 Spc29 zf-C3HC4_2 FliJ T3SSipB KxDL DUF1664 BLOC1_2 Fib_alpha SPATA24 DUF3450 LMBR1
Motif
Other DBs
NCBI-GeneID: 7187
NCBI-ProteinID: NP_003291
OMIM: 601896
HGNC: 12033
Ensembl: ENSG00000131323
Vega: OTTHUMG00000171902
Pharos: Q13114(Tbio)
UniProt: Q13114
LinkDB All DBs
Structure
PDB: 

Position
14q32.32
AA seq 568 aa AA seqDB search
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggcggccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaatgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacatgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagcttgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggttactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgtcatttgggagatgcattcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system