KEGG   Homo sapiens (human): 7187Help
Entry
7187              CDS       T01001                                 

Gene name
TRAF3, CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1, RNF118
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06114  PI3K signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00505  CD40-NFKB signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
N00728  IAV NS1 to RIG-I-like receptor signaling pathway
N00732  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7187 (TRAF3)
   04668 TNF signaling pathway
    7187 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7187 (TRAF3)
   04621 NOD-like receptor signaling pathway
    7187 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    7187 (TRAF3)
   04657 IL-17 signaling pathway
    7187 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7187 (TRAF3)
   05203 Viral carcinogenesis
    7187 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7187 (TRAF3)
  09172 Infectious disease: viral
   05162 Measles
    7187 (TRAF3)
   05164 Influenza A
    7187 (TRAF3)
   05161 Hepatitis B
    7187 (TRAF3)
   05160 Hepatitis C
    7187 (TRAF3)
   05168 Herpes simplex virus 1 infection
    7187 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7187 (TRAF3)
   05169 Epstein-Barr virus infection
    7187 (TRAF3)
   05165 Human papillomavirus infection
    7187 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF ATG16 MPS2 zf-C3HC4 Spc7 Tropomyosin_1 Spc29 zf-C3HC4_2 FliJ T3SSipB KxDL DUF1664 BLOC1_2 Fib_alpha SPATA24 DUF3450 LMBR1
Motif
Other DBs
NCBI-GeneID: 7187
NCBI-ProteinID: NP_003291
OMIM: 601896
HGNC: 12033
Ensembl: ENSG00000131323
Vega: OTTHUMG00000171902
Pharos: Q13114(Tbio)
UniProt: Q13114
LinkDB All DBs
Structure
PDB: 

Position
14q32.32
AA seq 568 aa AA seqDB search
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggcggccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaatgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacatgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagcttgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggttactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgtcatttgggagatgcattcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

KEGG   Homo sapiens (human): 7188Help
Entry
7188              CDS       T01001                                 

Gene name
TRAF5, MGC:39780, RNF84
Definition
(RefSeq) TNF receptor associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06114  PI3K signaling (viruses)
nt06123  TNF signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7188 (TRAF5)
   04668 TNF signaling pathway
    7188 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7188 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7188 (TRAF5)
   04657 IL-17 signaling pathway
    7188 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7188 (TRAF5)
   05203 Viral carcinogenesis
    7188 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7188 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7188 (TRAF5)
   05168 Herpes simplex virus 1 infection
    7188 (TRAF5)
   05163 Human cytomegalovirus infection
    7188 (TRAF5)
   05169 Epstein-Barr virus infection
    7188 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7188 (TRAF5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7188 (TRAF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-C3HC4_4 zf-TRAF_2 Sina Spc29 zf-RING_6 zf-ACC ATG16 zf-RING_2 zf-RING_UBOX Acetyltransf_11 Mt_ATP_synt PHM7_cyt FlaC_arch DUF1664 DUF4279 Tropomyosin_1 Spc7
Motif
Other DBs
NCBI-GeneID: 7188
NCBI-ProteinID: NP_001029082
OMIM: 602356
HGNC: 12035
Ensembl: ENSG00000082512
Vega: OTTHUMG00000036997
Pharos: O00463(Tbio)
UniProt: O00463
LinkDB All DBs
Position
1q32.3
AA seq 557 aa AA seqDB search
MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQ
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcttattcagaagagcataaaggtatgccctgtggtttcatccgccagaattccggc
aactccatttccttggactttgagcccagtatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagataaagaggtcatcaaatctcaggaggtttttaaagacaattgttgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaatgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaacctgtgcagtgttct
aatgagaagtgccgggagccagtcctacggaaagacctgaaagagcatttgagtgcatcc
tgtcagtttcgaaaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtagatgaacacctggctgtatgtcctgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcagcaa
catgagcattcagccttacgggagcacatgcgtttggttttagaaaagaatgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaattt
gacctgagacctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagccgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgagtaaaaatgaagagcgatttaaactgctggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagagaggcg
gtggatgggcacacagtgtccatcttcagccagtccttctacaccagccgctgtggctac
cggctctgtgctagagcatacctgaatggggatgggtcagggagggggtcacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgaccctgatgcttctggaccagagtggcaaaaagaacattatggagaccttcaaa
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctacattaaagat
gacactctgttcttgaaagtggccgtggacttaactgacctggaggatctctag

DBGET integrated database retrieval system