KEGG   Homo sapiens (human): 7188Help
Entry
7188              CDS       T01001                                 

Gene name
TRAF5, MGC:39780, RNF84
Definition
(RefSeq) TNF receptor associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06114  PI3K signaling (viruses)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7188 (TRAF5)
   04668 TNF signaling pathway
    7188 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7188 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7188 (TRAF5)
   04657 IL-17 signaling pathway
    7188 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7188 (TRAF5)
   05203 Viral carcinogenesis
    7188 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7188 (TRAF5)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7188 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7188 (TRAF5)
   05168 Herpes simplex virus 1 infection
    7188 (TRAF5)
   05163 Human cytomegalovirus infection
    7188 (TRAF5)
   05169 Epstein-Barr virus infection
    7188 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7188 (TRAF5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7188 (TRAF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-C3HC4_4 zf-TRAF_2 Sina Spc29 zf-RING_6 zf-ACC ATG16 zf-RING_2 zf-RING_UBOX Acetyltransf_11 Mt_ATP_synt PHM7_cyt FlaC_arch DUF1664 DUF4279 Tropomyosin_1 Spc7
Motif
Other DBs
NCBI-GeneID: 7188
NCBI-ProteinID: NP_001029082
OMIM: 602356
HGNC: 12035
Ensembl: ENSG00000082512
Vega: OTTHUMG00000036997
Pharos: O00463(Tbio)
UniProt: O00463
LinkDB All DBs
Position
1q32.3
AA seq 557 aa AA seqDB search
MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQ
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcttattcagaagagcataaaggtatgccctgtggtttcatccgccagaattccggc
aactccatttccttggactttgagcccagtatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagataaagaggtcatcaaatctcaggaggtttttaaagacaattgttgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaatgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaacctgtgcagtgttct
aatgagaagtgccgggagccagtcctacggaaagacctgaaagagcatttgagtgcatcc
tgtcagtttcgaaaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtagatgaacacctggctgtatgtcctgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcagcaa
catgagcattcagccttacgggagcacatgcgtttggttttagaaaagaatgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaattt
gacctgagacctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagccgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgagtaaaaatgaagagcgatttaaactgctggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagagaggcg
gtggatgggcacacagtgtccatcttcagccagtccttctacaccagccgctgtggctac
cggctctgtgctagagcatacctgaatggggatgggtcagggagggggtcacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgaccctgatgcttctggaccagagtggcaaaaagaacattatggagaccttcaaa
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctacattaaagat
gacactctgttcttgaaagtggccgtggacttaactgacctggaggatctctag

DBGET integrated database retrieval system