KEGG   Homo sapiens (human): 7189Help
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00564  HSV US3 to TLR3-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
   04140 Autophagy - animal
    7189 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
   04657 IL-17 signaling pathway
    7189 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7189 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7189 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    7189 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7189 (TRAF6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7189 (TRAF6)
   05132 Salmonella infection
    7189 (TRAF6)
   05131 Shigellosis
    7189 (TRAF6)
   05135 Yersinia infection
    7189 (TRAF6)
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05161 Hepatitis B
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex virus 1 infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    7189 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7189 (TRAF6)
   04121 Ubiquitin system [BR:hsa04121]
    7189 (TRAF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7189 (TRAF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    7189 (TRAF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7189 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX U-box Tropomyosin_1 zf-RING_11 Spc29 ADIP EzrA UPF0242 DUF16 DM Dynactin_p22 Sina FliJ AAA_13 Filament CENP-F_leu_zip DUF3450 HMMR_N DUF1664 PspA_IM30 Lebercilin
Motif
Other DBs
NCBI-GeneID: 7189
NCBI-ProteinID: NP_004611
OMIM: 602355
HGNC: 12036
Ensembl: ENSG00000175104
Vega: OTTHUMG00000166391
Pharos: Q9Y4K3(Tbio)
UniProt: Q9Y4K3
LinkDB All DBs
Structure
PDB: 

Position
11p12
AA seq 522 aa AA seqDB search
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

KEGG   Homo sapiens (human): 6885Help
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, CSCF, FMD2, MEKK7, TAK1, TGF1a
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04520  Adherens junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00564  HSV US3 to TLR3-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00928  Escherichia NleB to TNF-NFKB signaling pathway
N00944  Shigella OspI to TNF-NFKB signaling pathway
N00945  Shigella IpaH1.4/2.5 to TNF-NFKB signaling pathway
Disease
H02226  Cardiospondylocarpofacial syndrome
H02227  Frontometaphyseal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6885 (MAP3K7)
   04310 Wnt signaling pathway
    6885 (MAP3K7)
   04064 NF-kappa B signaling pathway
    6885 (MAP3K7)
   04668 TNF signaling pathway
    6885 (MAP3K7)
   04152 AMPK signaling pathway
    6885 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6885 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6885 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6885 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    6885 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    6885 (MAP3K7)
   04660 T cell receptor signaling pathway
    6885 (MAP3K7)
   04657 IL-17 signaling pathway
    6885 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    6885 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6885 (MAP3K7)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    6885 (MAP3K7)
   05132 Salmonella infection
    6885 (MAP3K7)
   05131 Shigellosis
    6885 (MAP3K7)
   05135 Yersinia infection
    6885 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6885 (MAP3K7)
   05162 Measles
    6885 (MAP3K7)
   05161 Hepatitis B
    6885 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    6885 (MAP3K7)
   05169 Epstein-Barr virus infection
    6885 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    6885 (MAP3K7)
   05140 Leishmaniasis
    6885 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6885 (MAP3K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     6885 (MAP3K7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   6885 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 6885
NCBI-ProteinID: NP_663304
OMIM: 602614
HGNC: 6859
Ensembl: ENSG00000135341
Vega: OTTHUMG00000015217
Pharos: O43318(Tchem)
UniProt: O43318
LinkDB All DBs
Structure
PDB: 

Position
6q15
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgattactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

KEGG   Homo sapiens (human): 23118Help
Entry
23118             CDS       T01001                                 

Gene name
TAB2, CHTD2, MAP3K7IP2, TAB-2
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
N00928  Escherichia NleB to TNF-NFKB signaling pathway
N00944  Shigella OspI to TNF-NFKB signaling pathway
N00945  Shigella IpaH1.4/2.5 to TNF-NFKB signaling pathway
Disease
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
   04657 IL-17 signaling pathway
    23118 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    23118 (TAB2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23118 (TAB2)
   05132 Salmonella infection
    23118 (TAB2)
   05131 Shigellosis
    23118 (TAB2)
   05135 Yersinia infection
    23118 (TAB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    23118 (TAB2)
   05162 Measles
    23118 (TAB2)
   05161 Hepatitis B
    23118 (TAB2)
   05168 Herpes simplex virus 1 infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP DLP_helical DivIC
Motif
Other DBs
NCBI-GeneID: 23118
NCBI-ProteinID: NP_001278963
OMIM: 605101
HGNC: 17075
Ensembl: ENSG00000055208 ENSG00000228408
Vega: OTTHUMG00000015783
Pharos: Q9NYJ8(Tbio)
UniProt: Q9NYJ8
LinkDB All DBs
Structure
PDB: 

Position
6q25.1
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system