KEGG   Homo sapiens (human): 719
Entry
719               CDS       T01001                                 

Gene name
C3AR1, AZ3B, C3AR, HNFAG09
Definition
(RefSeq) complement C3a receptor 1
  KO
K04009  C3a anaphylatoxin chemotactic receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    719 (C3AR1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    719 (C3AR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    719 (C3AR1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    719 (C3AR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    719 (C3AR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    719 (C3AR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 719
NCBI-ProteinID: NP_001313404
OMIM: 605246
HGNC: 1319
Ensembl: ENSG00000171860
Vega: OTTHUMG00000168569
Pharos: Q16581(Tchem)
UniProt: Q16581 A8K2H7
LinkDB
Position
12p13.31
AA seq 482 aa
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIW
FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDR
CLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSS
SLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD
SLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA
SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV
FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC
IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNST
TV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgtctttctctgctgagaccaattcaactgacctactctcacagccatggaatgag
cccccagtaattctctccatggtcattctcagccttacttttttactgggattgccaggc
aatgggctggtgctgtgggtggctggcctgaagatgcagcggacagtgaacacaatttgg
ttcctccacctcaccttggcggacctcctctgctgcctctccttgcccttctcgctggct
cacttggctctccagggacagtggccctacggcaggttcctatgcaagctcatcccctcc
atcattgtcctcaacatgtttgccagtgtcttcctgcttactgccattagcctggatcgc
tgtcttgtggtattcaagccaatctggtgtcagaatcatcgcaatgtagggatggcctgc
tctatctgtggatgtatctgggtggtggcttttgtgatgtgcattcctgtgttcgtgtac
cgggaaatcttcactacagacaaccataatagatgtggctacaaatttggtctctccagc
tcattagattatccagacttttatggagatccactagaaaacaggtctcttgaaaacatt
gttcagccgcctggagaaatgaatgataggttagatccttcctctttccaaacaaatgat
catccttggacagtccccactgtcttccaacctcaaacatttcaaagaccttctgcagat
tcactccctaggggttctgctaggttaacaagtcaaaatctgtattctaatgtatttaaa
cctgctgatgtggtctcacctaaaatccccagtgggtttcctattgaagatcacgaaacc
agcccactggataactctgatgcttttctctctactcatttaaagctgttccctagcgct
tctagcaattccttctacgagtctgagctaccacaaggtttccaggattattacaattta
ggccaattcacagatgacgatcaagtgccaacacccctcgtggcaataacgatcactagg
ctagtggtgggtttcctgctgccctctgttatcatgatagcctgttacagcttcattgtc
ttccgaatgcaaaggggccgcttcgccaagtctcagagcaaaacctttcgagtggccgtg
gtggtggtggctgtctttcttgtctgctggactccataccacatttttggagtcctgtca
ttgcttactgacccagaaactcccttggggaaaactctgatgtcctgggatcatgtatgc
attgctctagcatctgccaatagttgctttaatcccttcctttatgccctcttggggaaa
gattttaggaagaaagcaaggcagtccattcagggaattctggaggcagccttcagtgag
gagctcacacgttccacccactgtccctcaaacaatgtcatttcagaaagaaatagtaca
actgtgtga

DBGET integrated database retrieval system