KEGG   Homo sapiens (human): 7220Help
Entry
7220              CDS       T01001                                 

Gene name
TRPC1, HTRP-1, TRP1
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04929  GnRH secretion
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    7220 (TRPC1)
  09154 Digestive system
   04972 Pancreatic secretion
    7220 (TRPC1)
  09156 Nervous system
   04724 Glutamatergic synapse
    7220 (TRPC1)
   04726 Serotonergic synapse
    7220 (TRPC1)
  09158 Development and regeneration
   04360 Axon guidance
    7220 (TRPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7220 (TRPC1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7220 (TRPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 7220
NCBI-ProteinID: NP_001238774
OMIM: 602343
HGNC: 12333
Ensembl: ENSG00000144935
Vega: OTTHUMG00000159301
Pharos: P48995(Tbio)
UniProt: P48995
LinkDB All DBs
Position
3q23
AA seq 793 aa AA seqDB search
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS
EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK
QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF
WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF
HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF
LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW
KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW
RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG
FRTSKYAMFYPRN
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctcgggcgcctcctcctcctccctgcct
tcctctccatcctcttcctcgccgaacgaggtgatggcgctgaaggatgtgcgggaggtg
aaggaggagaatacgctgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaaacttggatatactg
cagcttcttttggactacggttgtcagtctgcagatgcacttttggtggcaatcgactct
gaagtagtgggagctgttgatatactacttaatcatcgaccaaaacgatcatcaagacca
actatagtaaaactaatggaacgaattcagaatcctgagtattcaacaactatggatgtt
gcacctgtcattttagctgctcatcgtaacaactatgaaattcttacaatgctcttaaaa
caggatgtatctctacccaagccccatgcagttggctgtgaatgcacattgtgttctgca
aaaaacaaaaaggatagcctccggcattccaggtttcgtcttgatatatatcgatgtttg
gccagtccagctctaataatgttaacagaggaggatccaattctgagagcatttgaactt
agtgctgatttaaaagaactaagtcttgtggaggtggaattcaggaatgattatgaggaa
ctagcccggcaatgtaaaatgtttgctaaggatttacttgcacaagcccggaattctcgt
gaattggaagttattctaaaccatacgtctagtgacgagcctcttgacaaacggggatta
ttagaagaaagaatgaatttaagtcgtctaaaacttgctatcaaatataaccagaaagag
tttgtctcccagtctaactgccagcagttcctgaacactgtttggtttggacagatgtcg
ggttaccgacgcaagcccacctgtaagaagataatgactgttttgacagtaggcatcttt
tggccagttttgtcactttgttatttgatagctcccaaatctcagtttggcagaatcatt
cacacaccttttatgaaatttatcattcatggagcatcatatttcacatttctgctgttg
cttaatctatactctcttgtctacaatgaggataagaaaaacacaatggggccagccctt
gaaagaatagactatcttcttattctgtggattattgggatgatttggtcagacattaaa
agactctggtatgaagggttggaagactttttagaagaatctcgtaatcaactcagtttt
gtcatgaattctctttatttggcaacctttgccctcaaagtggttgctcacaacaagttt
catgattttgctgatcggaaggattgggatgcattccatcctacactggtggcagaaggg
ctttttgcatttgcaaatgttctaagttatcttcgtctcttttttatgtatacaaccagc
tctatcttgggtccattacagatttcaatgggacagatgttacaagattttggaaaattt
cttgggatgtttcttcttgttttgttttctttcacaattggactgacacaactgtatgat
aaaggatatacttcaaaggagcagaaggactgtgtaggcatcttctgtgaacagcaaagc
aatgataccttccattcgttcattggcacctgctttgctttgttctggtatattttctcc
ttagcgcatgtggcaatctttgtcacaagatttagctatggagaagaactgcagtccttt
gtgggagctgtcattgttggtacatacaatgtcgtggttgtgattgtgcttaccaaactg
ctggtggcaatgcttcataaaagctttcagttgatagcaaatcatgaagacaaagaatgg
aagtttgctcgagcaaaattatggcttagctactttgatgacaaatgtacgttacctcca
cctttcaacatcattccctcaccaaagactatctgctatatgattagtagcctcagtaag
tggatttgctctcatacatcaaaaggcaaggtcaaacggcaaaacagtttaaaggaatgg
aggaatttgaaacagaagagagatgaaaactatcaaaaagtgatgtgctgcctagtgcat
cgttacttgacttccatgagacagaagatgcaaagtacagatcaggcaactgtggaaaat
ctaaacgaactgcgccaagatctgtcaaaattccgaaatgaaataagggatttacttggc
tttcggacttctaaatatgctatgttttatccaagaaattaa

KEGG   Homo sapiens (human): 7222Help
Entry
7222              CDS       T01001                                 

Gene name
TRPC3, SCA41, TRP3
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 3
  KO
K04966  transient receptor potential cation channel subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    7222 (TRPC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7222 (TRPC3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7222 (TRPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 7222
NCBI-ProteinID: NP_003296
OMIM: 602345
HGNC: 12335
Ensembl: ENSG00000138741
Vega: OTTHUMG00000133069
Pharos: Q13507(Tchem)
UniProt: Q13507
LinkDB All DBs
Structure
PDB: 

Position
4q27
AA seq 848 aa AA seqDB search
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLE
ESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEA
ILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLL
MKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALE
LSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVH
RHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGL
PFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVT
DYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIF
IAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEG
LYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYS
YYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVV
VLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFI
MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMK
RLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKL
NPSMLRCE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggagggaagcccatccctgagacgcatgacagtgatgcgggagaagggccggcgccag
gctgtcaggggcccggccttcatgttcaatgaccgcggcaccagcctcaccgccgaggag
gagcgcttcctcgacgccgccgagtacggcaacatcccagtggtgcgcaagatgctggag
gagtccaagacgctgaacgtcaactgcgtggactacatgggccagaacgcgctgcagctg
gctgtgggcaacgagcacctggaggtgaccgagctgctgctcaagaaggagaacctggcg
cgcattggcgacgccctgctgctcgccatcagcaagggctacgtgcgcatcgtagaggcc
atcctcaaccaccctggcttcgcggccagcaagcgtctcactctgagcccctgtgagcag
gagctgcaggacgacgacttctacgcttacgacgaggacggcacgcgcttctcgccggac
atcacccccatcatcctggcggcgcactgccagaaatacgaagtggtgcacatgctgctg
atgaagggtgccaggatcgagcggccgcacgactatttctgcaagtgcggggactgcatg
gagaagcagaggcacgactccttcagccactcacgctcgaggatcaatgcctacaagggg
ctggccagcccggcttacctctcattgtccagcgaggacccggtgcttacggccctagag
ctcagcaacgagctggccaagctggccaacatagagaaggagttcaagaatgactatcgg
aagctctccatgcaatgcaaagactttgtagtgggtgtgctggatctctgccgagactca
gaagaggtagaagccattctgaatggagatctggaatcagcagagcctctggaggtacac
aggcacaaagcttcattaagtcgtgtcaaacttgccattaagtatgaagtcaaaaagttt
gtggctcatcccaactgccagcagcagctcttgacgatctggtatgagaacctctcaggc
ctaagggagcagaccatagctatcaagtgtctcgttgtgctggtcgtggccctgggcctt
ccattcctggccattggctactggatcgcaccttgcagcaggctggggaaaattctgcga
agcccttttatgaagtttgtagcacatgcagcttctttcatcatcttcctgggtctgctt
gtgttcaatgcctcagacaggttcgaaggcatcaccacgctgcccaatatcacagttact
gactatcccaaacagatcttcagggtgaaaaccacccagtttacatggactgaaatgcta
attatggtctgggttcttggaatgatgtggtctgaatgtaaagagctctggctggaagga
cctagggaatacattttgcagttgtggaatgtgcttgactttgggatgctgtccatcttc
attgctgctttcacagccagattcctagctttccttcaggcaacgaaggcacaacagtat
gtggacagttacgtccaagagagtgacctcagtgaagtgacactcccaccagagatacag
tatttcacttatgctagagataaatggctcccttctgaccctcagattatatctgaaggc
ctttatgccatagctgttgtgctcagcttctctcggattgcgtacatcctccctgcaaat
gagagctttggccccctgcagatctctcttggaaggactgtaaaggacatattcaagttc
atggtcctctttattatggtgttttttgcctttatgattggcatgttcatactttattct
tactaccttggggctaaagttaatgctgcttttaccactgtagaagaaagtttcaagact
ttattttggtcaatatttgggttgtctgaagtgacttccgttgtgctcaaatatgatcac
aaattcatagaaaatattggatacgttctttatggaatatacaatgtaactatggtggtc
gttttactcaacatgctaattgctatgattaatagctcatatcaagaaattgaggatgac
agtgatgtagaatggaagtttgctcgttcaaaactttggttatcctattttgatgatgga
aaaacattacctccacctttcagtctagttcctagtccaaaatcatttgtttatttcatc
atgcgaattgttaactttcccaaatgcagaaggagaaggcttcagaaggatatagaaatg
ggaatgggtaactcaaagtccaggttaaacctcttcactcagtctaactcaagagttttt
gaatcacacagttttaacagcattctcaatcagccaacacgttatcagcagataatgaaa
agacttataaagcggtatgttttgaaagcacaagtagacaaagaaaatgatgaagttaat
gaaggtgaattaaaagaaatcaagcaagatatctccagccttcgttatgaacttttggaa
gacaagagccaagcaactgaggaattagccattctaattcataaacttagtgagaaactg
aatcccagcatgctgagatgtgaatga

KEGG   Homo sapiens (human): 7223Help
Entry
7223              CDS       T01001                                 

Gene name
TRPC4, HTRP-4, HTRP4, TRP4
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 4
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    7223 (TRPC4)
  09158 Development and regeneration
   04360 Axon guidance
    7223 (TRPC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7223 (TRPC4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7223 (TRPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 Ank_4 Ank_2 Ank_3 Ank PKD_channel
Motif
Other DBs
NCBI-GeneID: 7223
NCBI-ProteinID: NP_057263
OMIM: 603651
HGNC: 12336
Ensembl: ENSG00000133107
Vega: OTTHUMG00000016752
Pharos: Q9UBN4(Tbio)
UniProt: Q9UBN4
LinkDB All DBs
Position
13q13.3
AA seq 977 aa AA seqDB search
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKESSNSADSDEK
SDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIP
GLSEQCVLVDHRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYD
LNLPDTVTHEDYVTTRL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttctattacaaaagaaatgttaatgctccctatagagaccgcatccctcta
aggatagtaagagcagaatcagaactctcgccatcagaaaaagcctacttgaatgctgtg
gaaaagggagattatgccagtgtcaagaaatccctagaggaagctgaaatttattttaaa
atcaatattaattgcattgatcctctcggaagaactgctctcctcattgcaattgaaaat
gagaacttggagctcatcgaactactcttaagctttaatgtctatgttggagatgctcta
ttacatgctatcagaaaagaagtcgtcggagctgttgagctgttattgaaccacaaaaaa
cctagtggagaaaaacaggtgcctcctatactccttgataagcagttctctgaattcact
ccagacattacaccaatcattttggcagcccatacaaataattatgagataataaaactc
ttggttcagaaaggagtctcagtgcctcgaccccacgaggtccgctgtaactgtgtggaa
tgcgtgtccagttcagatgtggacagcctccgtcactcacgctccagactcaacatctac
aaggccttggccagtccctctctcattgcactgtcaagcgaagatccttttctcacagcc
tttcagttaagttgggaacttcaggaactgagcaaggtggaaaatgaattcaagtcggag
tatgaagagctgtcacggcagtgcaaacaatttgctaaggacctactggatcagacgaga
agttccagagaactggaaatcattcttaattaccgagatgacaatagtctcatagaagaa
caaagtggaaatgatcttgcaagactaaaattggccattaagtaccgtcaaaaagagttt
gttgcccagcccaattgtcaacagctgctggcatctcgctggtacgatgagtttccaggc
tggaggagaagacactgggcagtgaagatggtgacatgtttcataataggacttcttttt
cctgtcttctctgtgtgctacctgatagctcccaaaagcccacttggactgttcatcagg
aagccatttatcaagtttatctgccacacagcctcctatttgacttttttgttcctgctg
ctgcttgcctctcagcacatcgacaggtcagacttgaacaggcaaggtccaccaccaacc
atcgtcgagtggatgatattaccgtgggtcctgggcttcatatggggagaaattaaacag
atgtgggatggcggacttcaggactacatccatgattggtggaatctaatggactttgta
atgaactccttatatttagcaacaatctccttgaaaattgttgcatttgtaaagtacagt
gcccttaatccacgagaatcatgggacatgtggcatcccactctggtggcagaggcttta
tttgctattgcaaacatcttcagttctctgcgtctgatctcactgtttactgcaaattct
cacctgggacctctgcaaatatctctgggaagaatgctcctggacattttgaagtttcta
ttcatatactgccttgtgttgctagcatttgcaaatggcctaaatcaattgtacttctat
tatgaagaaacgaaagggttaacctgcaaaggcataagatgtgaaaagcagaataatgca
ttttcaacgttatttgagacactgcagtccctgttttggtcaatatttgggctcatcaat
ttatatgtgaccaatgtcaaagcacagcatgaatttactgagtttgttggtgccaccatg
tttgggacatacaatgtcatctctctggttgttctactcaacatgttaatagctatgatg
aataattcttaccaactgattgctgaccatgcagatatagaatggaaatttgcacgaaca
aagctttggatgagttattttgaagaaggaggtactctgcctactcccttcaatgtcatc
ccgagccccaagtctctctggtacctgatcaaatggatctggacacacttgtgcaagaaa
aagatgagaagaaagccagaaagttttggaacaatagggaggcgagctgctgataacttg
agaagacatcaccaataccaagaagttatgaggaacctggtgaagcgatacgttgctgca
atgattagagatgctaaaactgaagaaggcctgaccgaagagaactttaaggaactaaag
caagacatttctagtttccgctttgaagtcctgggattactaagaggaagcaaactttcc
acaatacaatctgcgaatgcctcgaaggagtcttcaaattcggcagactcagatgaaaag
agtgatagcgaaggtaatagcaaggacaagaaaaagaatttcagcctttttgatttaacc
accctgattcatccgagatcagcagcaattgcctctgaaagacataacataagcaatggc
tctgccctggtggttcaggagccgcccagggagaagcagagaaaagtgaattttgtgacc
gatatcaaaaactttgggttatttcatagacgatcaaaacaaaatgctgctgagcaaaat
gcaaaccaaatcttctctgtttcagaagaagttgctcgtcaacaggctgcaggaccactt
gagagaaatattcaactggaatctcgaggattagcttcacggggtgacctgagcattccc
ggtctcagtgaacaatgtgtgttagtagaccatagagaaaggaatacggacacactgggg
ttacaggtaggaaagagagtgtgtccattcaagtcagagaaggtggtggtggaggacacg
gttcctataataccaaaggagaaacatgcaaaagaagaggactctagtatagactatgat
ctaaacctcccagacacagtcacccacgaagattacgtgaccacaagattgtga

KEGG   Homo sapiens (human): 7224Help
Entry
7224              CDS       T01001                                 

Gene name
TRPC5, PPP1R159, TRP5
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 5
  KO
K04968  transient receptor potential cation channel subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04929  GnRH secretion
Drug target
Clemizole (DG02846): D01705 D02013
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    7224 (TRPC5)
  09158 Development and regeneration
   04360 Axon guidance
    7224 (TRPC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7224 (TRPC5)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7224 (TRPC5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7224 (TRPC5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7224 (TRPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 Ank_2 Ank_4 Ank_3 PKD_channel Ank
Motif
Other DBs
NCBI-GeneID: 7224
NCBI-ProteinID: NP_036603
OMIM: 300334
HGNC: 12337
Ensembl: ENSG00000072315
Vega: OTTHUMG00000022212
Pharos: Q9UL62(Tchem)
UniProt: Q9UL62
LinkDB All DBs
Position
Xq23
AA seq 973 aa AA seqDB search
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRR
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSFSTSSTELSQR
DDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP
SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
LSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHK
WGDGQEEQVTTRL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcccaactgtactacaaaaaggtcaactactcaccgtacagagaccgcatccccctg
caaattgtgagggctgagacagagctctctgcagaggagaaggccttcctcaatgctgtg
gagaagggggactatgccactgtgaagcaggcccttcaggaggctgagatctactataat
gttaacatcaactgcatggaccccttgggccggagtgccctgctcattgccattgagaac
gagaacctggagatcatggagctactgctgaaccacagcgtgtatgtgggtgatgcattg
ctctatgccatacgcaaggaagtggtgggcgctgtggagcttctgctcagctacaggcgg
cccagcggagagaagcaggtccccactctgatgatggacacgcagttctctgaattcaca
ccggacatcactcccatcatgctggctgcccacaccaacaactacgaaatcatcaaattg
cttgtccaaaaacgggtcactatcccacggccccaccagatccgctgcaactgtgtggag
tgtgtgtctagttcagaggtagacagcctgcgccactctcgctcccgactgaacatctat
aaggctctggcaagcccctcactcattgccttatcaagtgaggaccccatcctaactgcc
ttccgtctgggctgggagctcaaggagctcagcaaggtggagaatgagttcaaggccgag
tatgaggagctctctcagcagtgcaagctctttgccaaagacctgctggaccaagctcgg
agctccagggaactggagatcatcctcaaccatcgagatgaccacagtgaagagcttgac
cctcagaagtaccatgacctggccaagttgaaggtggcaatcaaataccaccagaaagag
tttgttgctcagcccaactgccaacagttgcttgccaccctgtggtatgatggcttccct
ggatggcggcggaaacactgggtagtcaagcttctaacctgcatgaccattgggttcctg
tttcccatgctgtctatagcctacctgatctcacccaggagcaaccttgggctgttcatc
aagaaaccctttatcaagtttatctgccacacagcatcctatttgaccttcctctttatg
cttctcctggcttctcagcacattgtcaggacagaccttcatgtacaggggcctccccca
actgtcgtggaatggatgatattgccttgggttctaggtttcatttggggtgagattaag
gaaatgtgggatggtggatttactgaatacatccatgactggtggaacctgatggatttt
gcaatgaactccctctacctggcaactatttccctgaagattgtggcctatgtcaagtat
aatggttctcgtccaagggaggaatgggaaatgtggcacccgactctgattgcggaagca
ctcttcgcaatatccaacattttaagttcgttgcgtctcatatccctgttcacagccaac
tcccacttaggacctctgcagatctctttgggacgcatgctgcttgatatcctcaaattc
ctctttatctactgcctggtactactagcttttgccaatggactgaaccagctttacttc
tattatgaaaccagagctatcgatgagcctaacaactgcaaggggatccgatgtgagaaa
cagaacaatgccttctccacgctctttgagactcttcagtcactcttctggtctgtattt
ggccttttaaatctatatgtcaccaatgtgaaagccagacacgaattcaccgagtttgta
ggagctaccatgtttggaacatacaatgtcatctccctggtagtgctgctgaacatgctg
attgctatgatgaacaactcctatcagcttattgccgatcatgctgatatcgagtggaag
tttgcaaggacgaagctctggatgagttactttgatgaaggtggcaccttgccacctcct
ttcaacatcatccccagccccaagtcatttctataccttggtaactggttcaacaacacc
ttctgccccaaaagagaccctgacggtagacggagaaggcgcaacttgagaagtttcaca
gaacgcaatgctgacagcctgatacaaaatcaacattatcaggaagttatcaggaattta
gtcaaaagatatgtggctgctatgataagaaattccaaaacacatgagggacttacagaa
gaaaattttaaggaattaaagcaagacatctccagctttcggtatgaagtgcttgacctc
ttgggaaatagaaaacatccaaggagcttttccactagcagcactgaactgtctcagaga
gacgataataatgatggcagtggtggggctcgggccaaatccaagagtgtctcttttaat
ttaggctgcaagaaaaagacttgccatgggccacctctcatcagaaccatgccaaggtcc
agtggtgcccaaggaaagtcaaaagctgagtcatcaagcaaacgctccttcatgggtcct
tctctcaagaaactgggtctcctattctccaaatttaatggtcatatgtctgaacccagt
tcagagccaatgtacacaatttctgatggaattgttcagcagcactgtatgtggcaggac
atcagatattctcagatggagaaagggaaagcagaggcctgttctcaaagtgaaattaac
ctcagtgaggtagaattaggtgaagtccagggcgctgctcagagcagtgaatgccctcta
gcctgttccagctctcttcactgtgcatccagcatctgctcctcaaattctaaactttta
gactcctcagaggatgtatttgaaacttggggagaggcttgtgacttgctcatgcacaaa
tggggtgatggacaggaagaacaagttacaactcgcctctaa

KEGG   Homo sapiens (human): 7225Help
Entry
7225              CDS       T01001                                 

Gene name
TRPC6, FSGS2, TRP6
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 6
  KO
K04969  transient receptor potential cation channel subfamily C member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04360  Axon guidance
Disease
H00626  Focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    7225 (TRPC6)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    7225 (TRPC6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7225 (TRPC6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7225 (TRPC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 Ank_5 ING 7tm_1 CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 7225
NCBI-ProteinID: NP_004612
OMIM: 603652
HGNC: 12338
Ensembl: ENSG00000137672
Vega: OTTHUMG00000167483
Pharos: Q9Y210(Tchem)
UniProt: Q9Y210
LinkDB All DBs
Structure
PDB: 

Position
11q22.1
AA seq 931 aa AA seqDB search
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS
DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE
CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI
LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR
KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL
SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR
PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA
KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS
FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI
GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL
NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL
KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE
EKSQNTEDLAELIRELGEKLSMEPNQEETNR
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcccggcgttcgggccccggaggggcagttctccccggggcgctgccgga
gccgctgcgcggcgcaacgagagccaggactatctgctcatggactcggagctgggagaa
gacggctgcccgcaagccccgctgccttgctacggctactacccctgcttccggggatct
gacaacagactggctcaccggcggcagacagttctccgtgagaaggggagaaggttagct
aatcgaggaccagcatacatgtttagtgatcgctccacaagcctatctatagaggaggaa
cgctttttggatgcagctgaatatggtaacatcccagtggtgcggaagatgttagaagaa
tgccactcactcaacgttaactgtgtggattacatgggccagaatgccctacagttggca
gtggccaatgagcatctggaaattacagaacttcttctcaagaaagaaaacctctctcga
gttggggatgctttgcttctagctattagtaaaggttatgttcggattgtggaagcaatt
ctcagtcatccggcttttgctgaaggcaagaggttagcaaccagccctagccagtctgaa
ctccagcaagatgatttttatgcctatgatgaagatgggacacggttctcccatgatgtg
actccaatcattctggctgcccactgccaggaatatgaaattgtgcataccctcctgcgg
aagggtgctaggattgaacggcctcatgattatttctgcaagtgcaatgactgcaaccag
aaacagaagcatgactcgtttagccactccagatctaggattaatgcctataaaggcctg
gcaagtccggcttacctgtcattgtctagtgaagatccagtcatgacggctttagaactt
agcaatgaactggcagttctggccaatattgagaaagagttcaagaatgactacaaaaaa
ctgtcaatgcagtgcaaagactttgttgttggactccttgatctgtgcagaaacactgaa
gaagtcgaggccattctgaatggggatgttgaaacgctccagagtggtgatcacggtcgc
ccaaatctcagccgtttaaaacttgccattaaatatgaagtaaaaaaatttgtagctcat
ccaaactgccaacagcaacttctctccatttggtatgagaatctttctggtttacgacag
cagacaatggcggtcaagttccttgtggtccttgctgttgccattggactgcccttcctg
gctctcatttactggtttgctccatgcagcaagatggggaagataatgcgtggaccattc
atgaagtttgtagcacacgcagcctccttcaccatttttctgggactgctagtcatgaat
gcagctgacagatttgaaggcacaaaactccttcctaatgaaaccagcacagataatgca
aaacagctgttcaggatgaaaacatcctgcttctcatggatggagatgctcattatatcc
tgggtaataggcatgatatgggctgaatgtaaagaaatctggactcagggccccaaggaa
tatttgtttgagttgtggaacatgcttgattttggtatgttagcaattttcgcagcatca
ttcattgcgagattcatggcattttggcatgcttccaaagcccagagcatcattgacgca
aatgatactttgaaggacttgacgaaagtaacattgggagacaatgtgaaatactacaat
ttggccaggataaagtgggacccctctgatcctcaaataatatctgaaggtctttatgca
attgctgtagttttaagtttctctaggatagcttatattttaccagcaaatgaaagcttt
ggacctctgcagatatcacttggaagaacagtcaaagacatcttcaagttcatggtcata
ttcattatggtgtttgtggcctttatgattggaatgttcaatctctactcctactacatt
ggtgcaaaacaaaatgaagccttcacaacagttgaagagagttttaagacactgttctgg
gctatatttggactttctgaagtgaaatcagtggtcatcaactataaccacaaattcatt
gaaaacattggttacgttctttatggagtctataatgttacgatggtcattgttttgcta
aatatgttaattgccatgatcaacagttcattccaggaaattgaggatgacgctgatgtg
gagtggaaatttgcaagggccaaactctggttttcctactttgaggagggcagaacactt
cctgtacccttcaatctggtgccgagtccaaagtccctgttttatctcttactgaagctt
aaaaaatggatttctgagctgttccagggccataaaaaaggtttccaggaagatgcagag
atgaacaagataaatgaagaaaagaaacttggaattttaggaagtcatgaagacctttca
aaattatcacttgacaaaaaacaggttgggcacaataaacaaccaagtataaggagctca
gaagatttccatctaaatagtttcaataatcctccaagacaatatcagaaaataatgaaa
aggctcattaaaagatatgtactgcaggcccagatagataaggagagtgatgaagtgaac
gaaggggaactgaaggaaattaagcaggacatctcaagtctccgctatgaactccttgaa
gaaaaatctcagaatacagaagacctagcagaacttattagagaacttggagagaaatta
tccatggaaccaaatcaagaggaaaccaatagataa

DBGET integrated database retrieval system