KEGG   Homo sapiens (human): 7251Help
Entry
7251              CDS       T01001                                 

Gene name
TSG101, TSG10, VPS23
Definition
(RefSeq) tumor susceptibility 101
  KO
K12183  ESCRT-I complex subunit TSG101
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7251 (TSG101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7251 (TSG101)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7251 (TSG101)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    7251 (TSG101)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7251 (TSG101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UEV Vps23_core DUF3450 UQ_con Macoilin APG6_N GPS2_interact DUF1640 ERM Fzo_mitofusin Exonuc_VII_L FapA Prominin SlyX DUF3552 Spc7 DUF3492 TMPIT
Motif
Other DBs
NCBI-GeneID: 7251
NCBI-ProteinID: NP_006283
OMIM: 601387
HGNC: 15971
Ensembl: ENSG00000074319
Vega: OTTHUMG00000167725
Pharos: Q99816(Tbio)
UniProt: Q99816
LinkDB All DBs
Structure
PDB: 

Position
11p15.1
AA seq 390 aa AA seqDB search
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP
NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
KHVRLLSRKQFQLRALMQKARKTAGLSDLY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcggagagccagctcaagaaaatggtgtccaagtacaaatacagagaccta
actgtacgtgaaactgtcaatgttattactctatacaaagatctcaaacctgttttggat
tcatatgtttttaacgatggcagttccagggaactaatgaacctcactggaacaatccct
gtgccttatagaggtaatacatacaatattccaatatgcctatggctactggacacatac
ccatataatccccctatctgttttgttaagcctactagttcaatgactattaaaacagga
aagcatgttgatgcaaatgggaagatatatcttccttatctacatgaatggaaacaccca
cagtcagacttgttggggcttattcaggtcatgattgtggtatttggagatgaacctcca
gtcttctctcgtcctatttcggcatcctatccgccataccaggcaacggggccaccaaat
acttcctacatgccaggcatgccaggtggaatctctccatacccatccggataccctccc
aatcccagtggttacccaggctgtccttacccacctggtggtccatatcctgccacaaca
agttctcagtacccttctcagcctcctgtgaccactgttggtcccagtagggatggcaca
atcagcgaggacaccatccgagcctctctcatctctgcggtcagtgacaaactgagatgg
cggatgaaggaggaaatggatcgtgcccaggcagagctcaatgccttgaaacgaacagaa
gaagacctgaaaaagggtcaccagaaactggaagagatggttacccgtttagatcaagaa
gtagccgaggttgataaaaacatagaacttttgaaaaagaaggatgaagaactcagttct
gctctggaaaaaatggaaaatcagtctgaaaacaatgatatcgatgaagttatcattccc
acagctcccttatacaaacagatcctgaatctgtatgcagaagaaaacgctattgaagac
actatcttttacttgggagaagccttgagaaggggcgtgatagacctggatgtcttcctg
aagcatgtacgtcttctgtcccgtaaacagttccagctgagggcactaatgcaaaaagca
agaaagactgccggtctcagtgacctctactga

DBGET integrated database retrieval system