KEGG   Homo sapiens (human): 7284Help
Entry
7284              CDS       T01001                                 

Gene name
TUFM, COXPD4, EF-TuMT, EFTU, P43
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency (COXPD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    7284 (TUFM)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7284 (TUFM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7284 (TUFM)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Elongation factors
   7284 (TUFM)
 Prokaryotic Type
   7284 (TUFM)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    7284 (TUFM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7284 (TUFM)
  Exosomal proteins of breast cancer cells
   7284 (TUFM)
  Exosomal proteins of colorectal cancer cells
   7284 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 7284
NCBI-ProteinID: NP_003312
OMIM: 602389
HGNC: 12420
Ensembl: ENSG00000178952
Vega: OTTHUMG00000097039
Pharos: P49411(Tbio)
UniProt: P49411
LinkDB All DBs
Position
16p11.2
AA seq 455 aa AA seqDB search
MTTMAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVV
VYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQ
KLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSK
NIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILE
KGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatggcggccgccaccctgctgcgcgcgacgccccacttcagcggtctcgcc
gccggccggaccttcctgctgcagggtctgttgcggctgctgaaagccccggcattgcct
ctcttgtgccgcggcctggccgtggaggccaagaagacttacgtgcgcgacaagccacat
gtgaatgtgggtaccatcggccatgtggaccacgggaagaccacgctgactgcagccatc
acgaagattctagctgagggaggtggggctaagttcaagaagtacgaggagattgacaat
gccccggaggagcgagctcggggtatcaccatcaatgcggctcatgtggagtatagcact
gccgcccgccactacgcccacacagactgcccgggtcatgcagattatgttaagaatatg
atcacaggcactgcacccctcgacggctgcatcctggtggtagcagccaatgacggcccc
atgccccagacccgagagcacttattactggccagacagattggggtggagcatgtggtg
gtgtatgtgaacaaggctgacgctgtccaggactctgagatggtggaactggtggaactg
gagatccgggagctgctcaccgagtttggctataaaggggaggagaccccagtcatcgta
ggctctgctctctgtgcccttgagggtcgggaccctgagttaggcctgaagtctgtgcag
aagctactggatgctgtggacacttacatcccagtgcccgcccgggacctggagaagcct
ttcctgctgcctgtggaggcggtgtactccgtccctggccgtggcaccgtggtgacaggt
acactagagcgtggcattttaaagaagggagacgagtgtgagctcctaggacatagcaag
aacatccgcactgtggtgacaggcattgagatgttccacaagagcctggagagggccgag
gccggagataacctcggggccctggtccgaggcttgaagcgggaggacttgcggcggggc
ctggtcatggtcaagccaggttccatcaagccccaccagaaggtggaggcccaggtttac
atcctcagcaaggaggaaggtggccgccacaagccctttgtgtcccacttcatgcctgtc
atgttctccctgacttgggacatggcctgtcggattatcctgcccccagagaaggagctt
gccatgcccggggaggacctgaagttcaacctaatcttgcggcagccaatgatcttagag
aaaggccagcgtttcaccctgcgagatggcaaccggactattggcaccggtctagtcacc
aacacgctggccatgactgaggaggagaagaatatcaaatggggttga

DBGET integrated database retrieval system