KEGG   Homo sapiens (human): 728577
Entry
728577            CDS       T01001                                 

Gene name
CNTNAP3B
Definition
(RefSeq) contactin associated protein family member 3B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C Laminin_G_3 EGF Fibrinogen_C
Other DBs
NCBI-GeneID: 728577
NCBI-ProteinID: NP_001188309
HGNC: 32035
Ensembl: ENSG00000154529
Vega: OTTHUMG00000013174
UniProt: Q96NU0
LinkDB
Position
9p11.2
AA seq 1288 aa
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDSPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYTLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSNLDLNFEISFGGILSPGRSRAFTRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELQRGSGSFV
LFLKDGKLKLSLFQAGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGGCLGNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGALGSFRDL
QIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGN
PSGLYYIDADGSGPLGPFLVYCNMTADSAWTVVRHGGPDAVTLRGAPSGHPLSAVSFAYA
AGAGQLRAAVNLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTSWGGSLPDAQ
KCTCGLEGNCIDSQYYCNCDAGQNEWTSDTIVLSQKEHLPVTQIVMTDTGQPHSEADYTL
GPLLCRGDKSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFI
RIELRAPTEVTFSFDVGNGPCEVTVQSPTPFNDNQWHHVRAERNVKGASLQVDQLPQKMQ
PAPADGHVRLQLNSQLFIGGTATRQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAG
HCSTYGHLCRNGGRCREKRRGVTCDCAFSAYDGPFCSNEISAYFATGSSMTYHFQEHYTL
SENSSSLVSSLHRDVTLTREMITLSFRTTRTPSLLLYVSSFYEEYLSVILANNGSLQIRY
KLDRHQNPDAFTFDFKNMADGQLHQVKINREEAVVMVEVNQSAKKQVILSSGTEFNAVKS
LILGKVLEAAGADPDTRRAATSGFTGCLSAVRFGCAAPLKAALRPSGPSRVTVRGHVAPM
ARCAAGAASGSPARELAPRLAGGAGRSGPVDEGEPLVNADRRDSAVIGGVIAVEIFILLC
ITAIAIRIYQQRKLRKENESKVSKKEEC
NT seq 3867 nt   +upstreamnt  +downstreamnt
atggcttcagtggcctgggccgtcctcaaggtgctgctgcttctccccactcagacttgg
agccccgtaggagcaggaaatccacctgactgtgattccccactggcctctgccttgcct
aggtcatccttcagcagctcctcagagctgtccagcagccacggcccggggttttcaagg
cttaatcgaagagatggagctggtggctggaccccacttgtgtcaaataaataccaatgg
ctgcaaattgaccttggagagagaatggaggtcactgctgtcgccacccaaggaggatat
gggagctctgactgggtgaccagctacctcctgatgttcagtgatggtgggagaaactgg
aagcagtatcgccgagaagaaagcatctggggttttccaggaaacacaaacgcagacagt
gtggtgcactacagactccagcctccctttgaagccaggttcctgcgctttctcccttta
gcctggaaccccaggggcaggattgggatgcggatcgaagtgtacggatgtgcatataaa
tctgaggtggtttattttgatggacaaagtgctctgctgtatacacttgataaaaaacct
ttaaaaccaataagagatgttatttctttgaaatttaaagccatgcagagcaatggaatt
ctacttcacagagaaggacaacatggaaatcacattactctggaattaattaaaggaaag
cttgtcttttttcttaattcaggcaatgctaagctgccttctactattgctcctgtgacc
ctcaccctgggcagcctgctggatgaccagcactggcattccgtcctcatcgagctcctc
gacacgcaggtcaacttcaccgtggacaaacacactcatcatttccaagcaaagggagat
tccagtaacttggatcttaattttgagatcagctttgggggaattctgtcacccggaaga
tcacgggcattcacacgtaaaagctttcatgggtgtttagaaaatctttattataatgga
gtggatgttaccgaattagccaagaaacacaaaccacagatcctcatgatgggaaatgtg
tccttctcatgtccacagccacagactgtccctgtgacttttctgagctccaggagttat
ctggctctgccaggcaactctggggaggacaaagtgtctgtcacttttcaatttcgaacg
tggaacagagcaggacatttgcttttcggcgaacttcaacgtggttcagggagtttcgtc
ctctttcttaaggatggcaagctcaaactgagtctcttccaggcgggacagtcaccaagg
aatgtcacagcaggtgctggattaaacgatgggcagtggcactctgtatccttctctgcc
aagtggagccatatgaatgtggtggtggatgatgacacagctgttcagcccctggtggct
gtgctcattgattcaggtgacacctattattttggaggctgcctgggcaacagctctggc
tctggatgtaaaagccccctgggagggtttcagggctgcctaaggctcatcaccattggt
gacaaagcggtggatcccatcttagtacagcagggggcgctggggagtttcagggacctc
cagatagactcctgcggcatcacagacaggtgcttgcccagctactgtgagcatgggggc
gagtgttcccagtcgtgggacaccttctcctgtgactgtctaggcacaggctatacgggc
gagacctgccattcctctctctacgagcagtcttgtgaagcccacaagcaccgagggaac
ccatccgggctttactatattgatgcagatggaagtggccccctgggaccatttcttgtg
tactgcaatatgacagcagactccgcgtggacggtggtgcggcacggtggccccgacgcg
gtgaccctccgaggtgcccccagcgggcacccgctctcggctgtgtccttcgcgtacgca
gcgggcgcggggcagctgcgggccgcggtgaacctggcggagcgctgcgagcagcggctg
gctctgcgctgcgggacagcgcggcgcccggactcacgagatggaaccccactgagctgg
tgggttggaagaaccaatgaaacacacacttcctggggaggttctctgcctgatgctcaa
aagtgtacttgtggattagaggggaactgcattgattctcagtattactgcaactgtgat
gctggccagaatgaatggactagtgacacaatagtcctttcccaaaaggagcacctccca
gtcactcagattgtgatgacagacacaggccaaccacattccgaagcagattatacactg
gggccactgctctgccgcggagataagtcattttggaattcagcttccttcaacactgag
acttcataccttcatttccctgctttccacggagaactcactgctgacgtgtgcttcttt
tttaagaccacagtttcctctggggtgtttatggagaacctggggatcacagacttcatc
aggattgagctgcgggctcccacagaagtgacattttccttcgatgtggggaatggacct
tgtgaggtcacggtgcagtcacccactccctttaatgacaatcagtggcaccacgtgagg
gcagagagaaatgttaaaggagcgtctcttcaagttgatcagcttcctcagaagatgcag
cctgcccctgctgatgggcacgttcgtttacagctcaacagccagctcttcattggtgga
acggccaccagacagagaggctttctaggatgcattcggtctctgcagttgaacggggtg
gccctggatctggaagaaagagccacagtgacgccaggagtggagccagggtgtgcagga
cactgcagcacctatggacacttgtgtcgcaatggagggagatgcagagagaaacgcagg
ggggtcacctgtgactgtgccttctcagcctatgatggaccgttctgctccaatgagatt
tccgcatatttcgcaactggctcctcaatgacataccattttcaagaacattacacttta
agtgaaaactccagctctctcgtttcttcattacacagagatgtaacattgaccagagaa
atgatcacactgagcttccgaaccacacgaactccgagcttattgctgtatgtgagctct
ttctatgaggaatacctttcagttatcctcgccaacaatggaagtttgcagattaggtac
aagctagatagacatcaaaatcctgatgcatttacctttgattttaaaaacatggctgat
gggcaacttcaccaagtgaagattaacagagaagaagccgtggtcatggtagaggttaac
cagagcgcaaagaaacaagtcatcttgtcctcagggacagaattcaacgccgtcaaatct
ctcatattgggaaaggttttagaggctgccggcgcggacccggacacaaggcgggcggcg
actagtggcttcactggctgcctctcggcggtgcgcttcggctgcgctgctcccctgaag
gcggcgctgcgccccagcggcccctcccgggtcaccgtccgcggccacgtggcccctatg
gcccgctgcgcggcgggggcggcgtccggctccccggcgcgggaactggctccccgactc
gcggggggcgcaggtcgttctggaccagtggatgagggagagcccttggttaatgcagac
agaagagactctgctgtcatcggaggtgtgatagcagtggagatatttattttgctttgc
atcactgccatagccatacgcatctatcaacagagaaagttacgcaaagaaaatgagtca
aaagtctcaaaaaaagaagagtgctag

DBGET integrated database retrieval system