KEGG   Homo sapiens (human): 730051Help
Entry
730051            CDS       T01001                                 

Gene name
ZNF814
Definition
(RefSeq) zinc finger protein 814
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    730051 (ZNF814)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    730051 (ZNF814)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    730051 (ZNF814)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf_UBZ zf-C2H2_jaz zf-C2H2_6 zf-C2H2_11 zinc_ribbon_15 zf-met C1_1
Motif
Other DBs
NCBI-GeneID: 730051
NCBI-ProteinID: NP_001138461
HGNC: 33258
Ensembl: ENSG00000204514
Vega: OTTHUMG00000183519
Pharos: B7Z6K7(Tdark)
UniProt: B7Z6K7
LinkDB All DBs
Position
19q13.43
AA seq 855 aa AA seqDB search
MAAAATLRLSAQGTVTFEDVAVNFTWEEWNLLSEAQRCLYRDVTLENLALISSLGCWCGV
EDEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLH
RCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFL
PRSGLLQQEASHTGEKSNSKTECVSPIQCGGAHYSCGESMKHFSTKHILSQHQRLLTREE
CYVCCECGKSFSKYASLSNHQRVHTEKKHECGECGKSFSKYVSFSNHQRVHTEKKHECGE
CGKSFSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTEKKHYECGECGKS
FSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTDKKHYECGECGKSFSQK
SSLIQHQRFHTGEKPYGCEECGKSFSSEGHLRSHQRVHAGERPFKCGECVKSFSHKRSLV
HHQRVHSGERPYQCGECGKSFSQKGNLVLHQRVHTGARPYECGECGKSFSSKGHLRNHQQ
IHTGDRLYECGECGKSFSHKGTLILHQRVHPRERSYGCGECGKSFSSIGHLRSHQRVHTG
ERPYECGECGKSFSHKRSLVHHQRMHTGERPYKCGDCGKSFNEKGHLRNHQRVHTTERPF
KCGECGKCFSHKGNLILHQHGHTGERPYVCRECGKLFKKKSHLLVHQRIHNGEKPYACEA
CQKFFRNKYQLIAHQRVHTGERPYECNDCGKSFTHSSTFCVHKRIHTGEKPYECSECGKS
FAESSSFTKHKRVHTGEKPYECSECGKSFAESSSLTKHKRVHTGEKPYKCEKCGKLFNKK
SHLLVHQSSHWRKAI
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcggctacgctgaggctctccgctcagggcacagtgacttttgaagatgtg
gctgtgaactttacctgggaggaatggaatctccttagtgaggctcagagatgcctgtac
cgtgatgtgacgctggagaacctggcacttatatcctccctgggttgttggtgtggagtg
gaagatgaggcggcaccttctaagcagagtatttatatacaaagagagactcaggtcagg
actcctatggcaggtgtgtctcccaagaaggcccacccctgtgagatgtgtggcccgatc
ttgggagacattttgcatgtggcagatcatcagggaacacatcacaagcagaaactgcac
aggtgtgaggcctgggggaataaattgtatgacagtggaaactttcatcagcaccagaat
gagcacattggagagaaaccctacagagggagtgttgaggaggcgttgtttgcaaagagg
tgtaagttgcatgtgtcaggggagtcatctgtcttcagtgagagtgggaaggactttttg
cccaggtcaggattactccagcaggaggccagtcacactggggagaagtcaaacagcaaa
actgagtgtgtgtctcccattcagtgtgggggagctcactacagctgtggagaatccatg
aaacattttagcaccaaacatatactcagtcagcaccagagactgctcactagagaagag
tgttatgtgtgctgtgaatgtgggaagtcctttagcaaatatgctagcttgagtaatcat
cagagagttcacactgaaaaaaaacatgaatgtggagaatgtgggaaatcctttagcaaa
tatgttagcttcagtaatcatcagagagttcacactgaaaaaaaacatgaatgtggagaa
tgtgggaaatcctttagcaaatatgttagcttcagtaatcatcagagagttcacactggg
aaaagaccttatgaatgtggagaatgtgggaaatcgtttagcaaatatgctagcttcagt
aatcatcagagagttcacactgaaaaaaaacattatgaatgtggagaatgtgggaaatcc
tttagcaaatatgttagcttcagtaatcatcagagagttcacactgggaaaagaccttat
gaatgtggagaatgtgggaaatcgtttagcaaatatgctagcttcagtaatcatcagaga
gttcacactgacaaaaaacattatgaatgtggagaatgtgggaaatcctttagtcaaaag
agcagcctcattcaacatcagcgatttcacactggagaaaaaccttatgggtgtgaagaa
tgtgggaaatcttttagttcagaaggacatcttaggagccatcaacgagttcacgccgga
gaaagacctttcaagtgtggagaatgtgtgaaatctttcagtcataagcgcagccttgtt
caccatcagcgagttcacagtggagaaagaccttatcagtgtggagaatgtgggaaatct
ttcagtcaaaagggcaacctcgttctacaccagcgagttcacactggagcaagaccttat
gagtgtggagaatgtgggaaatcatttagttcaaaaggacatcttaggaaccatcagcaa
attcacactggggacagactttatgagtgtggagagtgtgggaaatcttttagtcataaa
ggcaccctcattctacatcagcgagttcaccctagagaaagatcttatgggtgtggagaa
tgtgggaaatcttttagttcaatcgggcaccttaggagccatcagcgcgttcatactgga
gagaggccttatgagtgtggagaatgtgggaaatcttttagtcataagcgcagccttgtt
caccatcagcgcatgcacactggagaaagaccttacaagtgtggagactgtgggaaatct
tttaatgaaaaaggacaccttaggaatcatcagcgagttcacactacagaaagacctttt
aagtgtggggaatgtgggaaatgttttagtcacaagggtaacctcattctacaccagcat
ggccatactggagaaagaccttatgtatgtagggaatgtggaaaattatttaagaagaag
tctcacctccttgtacaccagagaattcacaatggagaaaagccatatgcttgtgaagct
tgtcagaaattttttagaaacaagtaccaactcattgcacatcagagagttcacactgga
gaaaggccttatgaatgcaatgattgtggaaaatcatttacccacagctctacattctgt
gttcataagcgaattcacactggagaaaagccttatgagtgcagtgaatgtggaaaatct
ttcgctgaaagctccagtttcacaaaacacaaaagagttcacactggagaaaagccttat
gagtgcagtgaatgtggaaaatcttttgctgaaagctccagtctcactaaacacaagaga
gttcacactggagaaaagccttataaatgtgagaaatgtgggaaattatttaacaagaag
tctcacctccttgtacaccagagttcacactggagaaaagccatatga

DBGET integrated database retrieval system