KEGG   Homo sapiens (human): 7322
Entry
7322              CDS       T01001                                 

Gene name
UBE2D2, E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH4, UBCH5B
Definition
(RefSeq) ubiquitin conjugating enzyme E2 D2
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N00942  Shigella OspG to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7322 (UBE2D2)
   04120 Ubiquitin mediated proteolysis
    7322 (UBE2D2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7322 (UBE2D2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7322 (UBE2D2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7322 (UBE2D2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7322 (UBE2D2)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 7322
NCBI-ProteinID: NP_003330
OMIM: 602962
HGNC: 12475
Ensembl: ENSG00000131508
Vega: OTTHUMG00000163282
Pharos: P62837(Tbio)
UniProt: P62837
LinkDB
Structure
PDB: 

Position
5q31.2
AA seq 147 aa
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNRIAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaattgaatgatctggcacgggaccctccagcacag
tgttcagcaggtcctgttggagatgatatgttccattggcaagctacaataatggggcca
aatgacagtccctatcagggtggagtatttttcttgacaattcatttcccaacagattac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtcttgatattctacgatcacagtggtctccagcactaactatttca
aaagtactcttgtccatctgttctctgttgtgtgatcccaatccagatgatcctttagtg
cctgagattgctcggatctacaaaacagatagagaaaagtacaacagaatagctcgggaa
tggactcagaagtatgcgatgtaa

DBGET integrated database retrieval system