KEGG   Homo sapiens (human): 735
Entry
735               CDS       T01001                                 

Gene name
C9, ARMD15, C9D
Definition
(RefSeq) complement C9
  KO
K04000  complement component 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    735 (C9)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    735 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    735 (C9)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    735 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    735 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1 eIF-5_eIF-2B
Other DBs
NCBI-GeneID: 735
NCBI-ProteinID: NP_001728
OMIM: 120940
HGNC: 1358
Ensembl: ENSG00000113600
Vega: OTTHUMG00000094767
Pharos: P02748(Tbio)
UniProt: P02748
LinkDB
Structure
PDB: 
6DLW 6H04 5FMW

Position
5p13.1
AA seq 559 aa
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcagcctgccggagctttgcagttgcaatctgcattttagaaataagcatcctcaca
gcacagtacacgaccagttatgacccagagctaacagaaagcagtggctctgcatcacac
atagactgcagaatgagcccctggagtgaatggtcacaatgcgatccttgtctcagacaa
atgtttcgttcaagaagcattgaggtctttggacaatttaatgggaaaagatgcaccgac
gctgtgggagacagacgacagtgtgtgcccacagagccctgtgaggatgctgaggatgac
tgcggaaatgactttcaatgcagtacaggcagatgcataaagatgcgacttcggtgtaat
ggtgacaatgactgcggagacttttcagatgaggatgattgtgaaagtgagccccgtccc
ccctgcagagacagagtggtagaagagtctgagctggcacgaacagcaggctatgggatc
aacattttagggatggatcccctaagcacaccttttgacaatgagttctacaatggactc
tgtaaccgggatcgggatggaaacactctgacatactaccgaagaccttggaacgtggct
tctttgatctatgaaaccaaaggcgagaaaaatttcagaaccgaacattacgaagaacaa
attgaagcatttaaaagtatcatccaagagaagacatcaaattttaatgcagctatatct
ctaaaatttacacccactgaaacaaataaagctgaacaatgttgtgaggaaacagcctcc
tcaatttctttacatggcaagggtagttttcggttttcatattccaaaaatgaaacttac
caactatttttgtcatattcttcaaagaaggaaaaaatgtttctgcatgtgaaaggagaa
attcatctgggaagatttgtaatgagaaatcgcgatgttgtgctcacaacaacttttgtg
gatgatataaaagctttgccaactacctatgaaaagggagaatattttgcctttttggaa
acctatggaactcactacagtagctctgggtctctaggaggactctatgaactaatatat
gttttggataaagcttccatgaagcggaaaggtgttgaactaaaagacataaagagatgc
cttgggtatcatctggatgtatctctggctttctctgaaatctctgttggagctgaattt
aataaagatgattgtgtaaagaggggagagggtagagctgtaaacatcaccagtgaaaac
ctcatagatgatgttgtttcactcataagaggtggaaccagaaaatatgcatttgaactg
aaagaaaagcttctccgaggaaccgtgattgatgtgactgactttgtcaactgggcctct
tccataaatgatgctcctgttctcattagtcaaaaactgtctcctatatataatctggtt
ccagtgaaaatgaaaaatgcacacctaaagaaacaaaacttggaaagagccattgaagac
tatatcaatgaatttagtgtaagaaaatgccacacatgccaaaatggaggtacagtgatt
ctaatggatggaaagtgtttgtgtgcctgcccattcaaatttgagggaattgcctgtgaa
atcagtaaacaaaaaatttctgaaggattgccagccctagagttccccaatgaaaaatag

DBGET integrated database retrieval system