KEGG   Homo sapiens (human): 7358
Entry
7358              CDS       T01001                                 

Gene name
UGDH, EIEE84, GDH, UDP-GlcDH, UDPGDH, UGD
Definition
(RefSeq) UDP-glucose 6-dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7358 (UGDH)
   00053 Ascorbate and aldarate metabolism
    7358 (UGDH)
   00520 Amino sugar and nucleotide sugar metabolism
    7358 (UGDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     7358 (UGDH)
SSDB
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh_C UDPG_MGDP_dh 3HCDH_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 7358
NCBI-ProteinID: NP_003350
OMIM: 603370
HGNC: 12525
Ensembl: ENSG00000109814
Vega: OTTHUMG00000099371
Pharos: O60701(Tbio)
UniProt: O60701
LinkDB
Structure
PDB: 

Position
4p14
AA seq 494 aa
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIP
KFSLQDPPNKKPKV
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtttgaaattaagaagatctgttgcatcggtgcaggctatgttggaggacccacatgt
agtgtcattgctcatatgtgtcctgaaatcagggtaacggttgttgatgtcaatgaatca
agaatcaatgcgtggaattctcctacacttcctatttatgagccaggactaaaagaagtg
gtagaatcctgtcgaggaaaaaatctttttttttctaccaatattgatgatgccatcaaa
gaagctgatcttgtatttatttctgtgaatactccaacaaaaacctatggaatggggaaa
ggccgggcagcagatctgaagtatattgaagcttgtgctagacgcattgtgcaaaactca
aatgggtacaaaattgtgactgagaaaagcacagttccagtgcgggcagcagaaagtatc
cgtcgcatatttgatgcaaacacaaaacccaacttgaatttacaggtgctgtccaaccct
gagtttctggcagagggaacagccatcaaggacctaaagaacccagacagagtactgatt
ggaggggatgaaactccagagggccagagagctgtgcaggccctgtgtgctgtatatgag
cactgggttcccagagaaaagatcctcaccactaatacttggtcttcagagctttccaaa
ctggcagcaaatgcttttcttgcccagagaataagcagcattaactccataagtgctctg
tgtgaagcaacaggagctgatgtagaagaggtagcaacagcgattggaatggaccagaga
attggaaacaagtttctaaaagccagtgttgggtttggtgggagctgtttccaaaaggat
gttctgaatttggtttatctctgtgaggctctgaatttgccagaagtagctcgttattgg
cagcaggtcatagacatgaatgactaccagaggaggaggtttgcttcccggatcatagat
agtctgtttaatacagtaactgataagaagatagctattttgggatttgcattcaaaaag
gacactggtgatacaagagaatcttctagtatatatattagcaaatatttgatggatgaa
ggtgcacatctacatatatatgatccaaaagtacctagggaacaaatagttgtggatctt
tctcatccaggtgtttcagaggatgaccaagtgtcccggctcgtgaccatttccaaggat
ccatatgaagcatgtgatggtgcccatgctgttgttatttgcactgagtgggacatgttt
aaggaattggattatgaacgcattcataaaaaaatgctaaagccagcctttatcttcgat
ggacggcgtgtcctggatgggctccacaatgaactacaaaccattggcttccagattgaa
acaattggcaaaaaggtgtcttcaaagagaattccatatgctccttctggtgaaattccg
aagtttagtcttcaagatccacctaacaagaaacctaaagtgtag

DBGET integrated database retrieval system