KEGG   Homo sapiens (human): 7380Help
Entry
7380              CDS       T01001                                 

Gene name
UPK3A, UP3A, UPIII, UPIIIA, UPK3
Definition
(RefSeq) uroplakin 3A
  KO
K19520  uroplakin-3a
Organism
hsa  Homo sapiens (human)
Pathway
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    7380 (UPK3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7380 (UPK3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7380 (UPK3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Uroplakin_II
Motif
Other DBs
NCBI-GeneID: 7380
NCBI-ProteinID: NP_008884
OMIM: 611559
HGNC: 12580
Ensembl: ENSG00000100373
Vega: OTTHUMG00000151339
Pharos: O75631(Tbio)
UniProt: O75631
LinkDB All DBs
Position
22q13.31
AA seq 287 aa AA seqDB search
MPPLWALLALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHE
VYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIG
DVSKASQILNAYLVRVGANGTCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQT
LWSDPIRTNQLTPYSTIDTWPGRRSGGMIVITSILGSLPFFLLVGFAGAIALSLVDMGSS
DGETTHDSQITQEAVPKSLGASESSYTSVNRGPPLDRAEVYSSKLQD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgctctgggccctgctggccctcggctgcctgcggttcggctcggctgtgaac
ctgcagccccaactggccagtgtgactttcgccaccaacaaccccacacttaccactgtg
gccttggaaaagcctctctgcatgtttgacagcaaagaggccctcactggcacccacgag
gtctacctgtatgtcctggtcgactcagccatttccaggaatgcctcagtgcaagacagc
accaacaccccactgggctcaacgttcctacaaacagagggtgggaggacaggtccctac
aaagctgtggcctttgacctgatcccctgcagtgacctgcccagcctggatgccattggg
gatgtgtccaaggcctcacagatcctgaatgcctacctggtcagggtgggtgccaacggg
acctgcctgtgggatcccaacttccagggcctctgtaacgcacccctgtcggcagccacg
gagtacaggttcaagtatgtcctggtcaatatgtccacgggcttggtagaggaccagacc
ctgtggtcagaccccatccgcaccaaccagctcaccccatactcgacgatcgacacgtgg
ccaggccggcggagcggaggcatgatcgtcatcacttccatcctgggctccctgcccttc
tttctacttgtgggttttgctggcgccattgccctcagcctcgtggacatggggagttct
gatggggaaacgactcacgactcccaaatcactcaggaggctgttcccaagtcgctgggg
gcctcggagtcttcctacacgtccgtgaaccgggggccgccactggacagggctgaggtg
tattccagcaagctccaagactga

DBGET integrated database retrieval system