KEGG   Homo sapiens (human): 7405
Entry
7405              CDS       T01001                                 

Gene name
UVRAG, DHTX, VPS38, p63
Definition
(RefSeq) UV radiation resistance associated
  KO
K21249  UV radiation resistance-associated gene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    7405 (UVRAG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7405 (UVRAG)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    7405 (UVRAG)
SSDB
Motif
Pfam: Atg14 VPS38 C2 HTH_1
Other DBs
NCBI-GeneID: 7405
NCBI-ProteinID: NP_003360
OMIM: 602493
HGNC: 12640
Ensembl: ENSG00000198382
Vega: OTTHUMG00000165319
Pharos: Q9P2Y5(Tbio)
UniProt: Q9P2Y5
LinkDB
Position
11q13.5
AA seq 699 aa
MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQ
LLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGG
KENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILL
QVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECL
QLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKEC
TAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSI
AVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKL
QFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKR
QSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGET
ERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTL
LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSA
VAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgagcgcctccgcgtcggtcgggggccccgtcccccagccacccccgggcccggccgct
gctctgcctcccggttctgccgcgcgggccctgcatgtggagctgccgtctcagcagcgg
cgtcttcgacatcttcggaacattgctgcccggaacattgttaatagaaatggccatcag
ctccttgatacctactttacacttcacttgtgtagtactgaaaagatatataaagaattt
tatagaagtgaagtgattaagaattccttgaatcccacgtggcgaagtctcgattttgga
attatgccagaccgtcttgatacatctgtgtcttgtttcgtggtgaagatatggggtgga
aaggagaacatctaccagctgttgattgaatggaaagtctgtttggatgggctgaaatac
ttgggtcagcagattcatgcccgaaaccaaaatgaaataatttttgggctgaatgatgga
tactatggtgctccatttgaacataagggttattcaaatgctcagaagactattcttctg
caggtggatcagaactgtgttcgcaattcttacgatgtcttctctttgctacggcttcat
agagcccagtgtgcaattaaacagactcaggtaactgttcagaaaattggaaaggaaatt
gaagaaaaactaagactcacatctacaagcaatgaactgaaaaaaaaaagtgaatgcctg
cagttaaaaattttggtgcttcagaatgaactggaacggcagaagaaagctttgggacgg
gaggtggcattactgcataagcaacaaattgcattacaagacaaaggaagtgcattttca
gctgagcacctcaaacttcaactccagaaggaatccctaaatgagctgaggaaggagtgc
actgcaaaaagagaactcttcttgaagactaatgctcagttgacaattcgttgcaggcag
ttactctctgagctttcctacatttaccctattgatttgaatgaacataaggattacttt
gtatgcggtgtcaagttgcctaattctgaggacttccaagcaaaagatgatggaagcatt
gctgttgcccttggttatactgcacatctggtctccatgatttcctttttcctacaagtg
cccctcagatatcctataattcataaggggtctagatcaacaatcaaagacaatatcaat
gacaaactgacggaaaaggagagagagtttccactgtatccaaaaggaggggagaagttg
cagtttgattatggtgtctatcttctgaacaaaaatatagcacagctaagatatcaacat
ggactagggactccagacttgcggcaaacccttcccaacctgaaaaacttcatggagcat
ggactaatggtcaggtgtgacagacatcacacctccagtgcaatccctgttcctaagaga
caaagctccatatttgggggtgcagatgtaggcttctctggggggatcccttcaccagac
aaaggacatcgaaaacgggccagctctgagaatgagagacttcagtacaaaacccctcct
cccagttacaactcagcattagcccagcctgtgaccaccgtcccctccatgggagagacc
gagagaaagataacatctctatcctcctccttggatacctccttggacttctccaaagaa
aacaagaaaaaaggagaggatctagttggcagcttaaacggaggccacgcgaatgtgcac
cctagccaagaacaaggagaagccctctccgggcaccgggccacagtcaatggcactctc
ctacccagcgagcaggccgggtccgccagtgtccagcttccaggcgagttccacccagtc
tcagaagctgagctctgctgtactgtggagcaagcagaagaaatcatcgggctggaagcc
acaggtttcgcctcaggtgatcagctagaagcatttaactgcatcccagtggacagtgct
gtggcagtagagtgtgacgaacaagttctgggagaatttgaagagttctcccgaaggatc
tatgcactgaatgaaaacgtatccagcttccgccggccgcgcaggagttccgataagtga

DBGET integrated database retrieval system