KEGG   Homo sapiens (human): 7408Help
Entry
7408              CDS       T01001                                 

Gene name
VASP
Definition
(RefSeq) vasodilator stimulated phosphoprotein
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    7408 (VASP)
   04022 cGMP-PKG signaling pathway
    7408 (VASP)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7408 (VASP)
   04530 Tight junction
    7408 (VASP)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    7408 (VASP)
   04666 Fc gamma R-mediated phagocytosis
    7408 (VASP)
   04670 Leukocyte transendothelial migration
    7408 (VASP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7408 (VASP)
   04147 Exosome [BR:hsa04147]
    7408 (VASP)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     7408 (VASP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7408 (VASP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1
Motif
Other DBs
NCBI-GeneID: 7408
NCBI-ProteinID: NP_003361
OMIM: 601703
HGNC: 12652
Ensembl: ENSG00000125753
Vega: OTTHUMG00000182124
Pharos: P50552(Tbio)
UniProt: P50552 A0A024R0V4
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 380 aa AA seqDB search
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacggtcatctgttccagccgggccactgtgatgctttatgatgatggcaac
aagcgatggctccctgctggcacgggtccccaggccttcagccgcgtccagatctaccac
aaccccacggccaattcctttcgcgtcgtgggccggaagatgcagcccgaccagcaggtg
gtcatcaactgtgccatcgtccggggtgtcaagtataaccaggccacccccaacttccat
cagtggcgcgacgctcgccaggtctggggcctcaacttcggcagcaaggaggatgcggcc
cagtttgccgccggcatggccagtgccctagaggcgttggaaggaggtgggccccctcca
cccccagcacttcccacctggtcggtcccgaacggcccctccccggaggaggtggagcag
cagaaaaggcagcagcccggcccgtcggagcacatagagcgccgggtctccaatgcagga
ggcccacctgctccccccgctgggggtccacccccaccaccaggacctccccctcctcca
ggtccccccccacccccaggtttgcccccttcgggggtcccagctgcagcgcacggagca
gggggaggaccaccccctgcaccccctctcccggcagcacagggccctggtggtggggga
gctggggccccaggcctggccgcagctattgctggagccaaactcaggaaagtcagcaag
caggaggaggcctcaggggggcccacagcccccaaagctgagagtggtcgaagcggaggt
gggggactcatggaagagatgaacgccatgctggcccggagaaggaaagccacgcaagtt
ggggagaaaacccccaaggatgaatctgccaatcaggaggagccagaggccagagtcccg
gcccagagtgaatctgtgcggagaccctgggagaagaacagcacaaccttgccaaggatg
aagtcgtcttcttcggtgaccacttccgagacccaaccctgcacgcccagctccagtgat
tactcggacctacagagggtgaaacaggagcttctggaagaggtgaagaaggaattgcag
aaagtgaaagaggaaatcattgaagccttcgtccaggagctgaggaagcggggttctccc
tga

DBGET integrated database retrieval system