KEGG   Homo sapiens (human): 7416
Entry
7416              CDS       T01001                                 

Gene name
VDAC1, PORIN, VDAC-1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06131  Apoptosis (viruses and bacteria)
nt06170  Influenza A virus (IAV)
nt06410  Calcium signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00745  IAV PB1-F2 to intrinsic apoptotic pathway
N00950  Shigella FimA to crosstalk between extrinsic and intrinsic apoptotic pathways
N00957  Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway
N00967  VGCC-Ca2+ -apoptotic pathway
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N00987  Mutation-caused aberrant Htt to transport of calcium
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
N01003  Mutation-caused aberrant Abeta to transport of calcium
N01004  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01006  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01007  Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway
N01008  Mutation-caused aberrant PSEN1 to mGluR5-Ca2+ -apoptotic pathway
N01031  Mutation-caused aberrant SNCA to VGCC-Ca2+ -apoptotic pathway
N01151  Mutation-inactivated SIGMAR1 to Ca2+ -apoptotic pathway
N01199  Scrapie conformation PrPSc to mGluR5-Ca2+ -apoptotic pathway
N01200  Scrapie conformation PrPSc to transport of calcium
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7416 (VDAC1)
   04022 cGMP-PKG signaling pathway
    7416 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7416 (VDAC1)
   04218 Cellular senescence
    7416 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7416 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    7416 (VDAC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7416 (VDAC1)
   05012 Parkinson disease
    7416 (VDAC1)
   05014 Amyotrophic lateral sclerosis
    7416 (VDAC1)
   05016 Huntington disease
    7416 (VDAC1)
   05017 Spinocerebellar ataxia
    7416 (VDAC1)
   05020 Prion disease
    7416 (VDAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    7416 (VDAC1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7416 (VDAC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7416 (VDAC1)
   05164 Influenza A
    7416 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7416 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7416 (VDAC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7416 (VDAC1)
Ion channels [BR:hsa04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   7416 (VDAC1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 7416
NCBI-ProteinID: NP_003365
OMIM: 604492
HGNC: 12669
Ensembl: ENSG00000213585
Vega: OTTHUMG00000129118
Pharos: P21796(Tbio)
UniProt: P21796 A0A1L1UHR1 B3KTS5
LinkDB
Structure
PDB: 

Position
5q31.1
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggctgtgccacccacgtatgccgatcttggcaaatctgccagggatgtcttcaccaag
ggctatggatttggcttaataaagcttgatttgaaaacaaaatctgagaatggattggaa
tttacaagctcaggctcagccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacagatggactgagtacggcctgacgtttacagagaaatggaataccgacaataca
ctaggcaccgagattactgtggaagatcagcttgcacgtggactgaagctgaccttcgat
tcatccttctcacctaacactgggaaaaaaaatgctaaaatcaagacagggtacaagcgg
gagcacattaacctgggctgcgacatggatttcgacattgctgggccttccatccggggt
gctctggtgctaggttacgagggctggctggccggctaccagatgaattttgagactgca
aaatcccgagtgacccagagcaactttgcagttggctacaagactgatgaattccagctt
cacactaatgtgaatgacgggacagagtttggcggctccatttaccagaaagtgaacaag
aagttggagaccgctgtcaatcttgcctggacagcaggaaacagtaacacgcgcttcgga
atagcagccaagtatcagattgaccctgacgcctgcttctcggctaaagtgaacaactcc
agcctgataggtttaggatacactcagactctaaagccaggtattaaactgacactgtca
gctcttctggatggcaagaacgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system