KEGG   Homo sapiens (human): 7423Help
Entry
7423              CDS       T01001                                 

Gene name
VEGFB, VEGFL, VRF
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
Drug target
Aflibercept: D09574
Aflibercept beta: D10819
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7423 (VEGFB)
   04015 Rap1 signaling pathway
    7423 (VEGFB)
   04010 MAPK signaling pathway
    7423 (VEGFB)
   04151 PI3K-Akt signaling pathway
    7423 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7423 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7423 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7423 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7423 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7423 (VEGFB)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   7423 (VEGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 7423
NCBI-ProteinID: NP_003368
OMIM: 601398
HGNC: 12681
Ensembl: ENSG00000173511
Vega: OTTHUMG00000167813
Pharos: P49765(Tclin)
UniProt: P49765 Q7LAP4
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 207 aa AA seqDB search
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcactcctgcagctggcccccgcccag
gcccctgtctcccagcctgatgcccctggccaccagaggaaagtggtgtcatggatagat
gtgtatactcgcgctacctgccagccccgggaggtggtggtgcccttgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagccagacagggctgccact
ccccaccaccgtccccagccccgttctgttccgggctgggactctgcccccggagcaccc
tccccagctgacatcacccatcccactccagccccaggcccctctgcccacgctgcaccc
agcaccaccagcgccctgacccccggacctgccgctgccgctgccgacgccgcagcttcc
tccgttgccaagggcggggcttag

DBGET integrated database retrieval system