KEGG   Homo sapiens (human): 7432
Entry
7432              CDS       T01001                                 

Gene name
VIP, PHM27
Definition
(RefSeq) vasoactive intestinal peptide
  KO
K05264  vasoactive intestinal peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7432 (VIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7432 (VIP)
SSDB
Motif
Pfam: Hormone_2 CBP_BcsR DUF4122
Other DBs
NCBI-GeneID: 7432
NCBI-ProteinID: NP_003372
OMIM: 192320
HGNC: 12693
Ensembl: ENSG00000146469
Vega: OTTHUMG00000015851
Pharos: P01282(Tbio)
CPD: C16119
UniProt: P01282
LinkDB
Structure
PDB: 
2RRI 2RRH

Position
6q25.2
AA seq 170 aa
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
NT seq 513 nt   +upstreamnt  +downstreamnt
atggacaccagaaataaggcccagctccttgtgctcctgactcttctcagtgtgctcttc
tcacagacttcggcatggcctctttacagggcaccttctgctctcaggttgggtgacaga
ataccctttgagggagcaaatgaacctgatcaagtttcattaaaagaagacattgacatg
ttgcaaaatgcattagctgaaaatgacacaccctattatgatgtatccagaaatgccagg
catgctgatggagttttcaccagtgacttcagtaaactcttgggtcaactttctgccaaa
aagtaccttgagtctcttatgggaaaacgtgttagcagtaacatctcagaagaccctgta
ccagtcaaacgtcactcagatgcagtcttcactgacaactatacccgccttagaaaacaa
atggctgtaaagaaatatttgaactcaattctgaatggaaagaggagcagtgagggagaa
tctcccgactttccagaagagttagaaaaatga

DBGET integrated database retrieval system