KEGG   Homo sapiens (human): 7436
Entry
7436              CDS       T01001                                 

Gene name
VLDLR, CAMRQ1, CARMQ1, CHRMQ1, VLDL-R, VLDLRCH
Definition
(RefSeq) very low density lipoprotein receptor
  KO
K20053  very low-density lipoprotein receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
Network
nt06415  PI3K signaling
nt06462  Spinocerebellar ataxia
  Element
N00963  RELN-VLDLR-PI3K signaling pathway
N00964  DAB1-overexpression to RELN-VLDLR-PI3K signaling pathway
Disease
H01204  Cerebellar ataxia, mental retardation (MR), and dysequilibrium syndrome (CAMRQ)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    7436 (VLDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7436 (VLDLR)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    7436 (VLDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition EGF_CA cEGF SGL EGF DUF4010
Other DBs
NCBI-GeneID: 7436
NCBI-ProteinID: NP_003374
OMIM: 192977
HGNC: 12698
Ensembl: ENSG00000147852
Vega: OTTHUMG00000019447
Pharos: P98155(Tbio)
UniProt: P98155
LinkDB
Structure
PDB: 
3DPR 1V9U 6BYV

Position
9p24.2
AA seq 873 aa
MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISC
GAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgggcacgtccgcgctctgggcgctctggctgctgctcgcgctgtgctgggcgccccgg
gagagcggcgccaccggaaccgggagaaaagccaaatgtgaaccctcccaattccagtgc
acaaatggtcgctgtattacgctgttgtggaaatgtgatggggatgaagactgtgttgac
ggcagtgatgaaaagaactgtgtaaagaagacgtgtgctgaatctgacttcgtgtgcaac
aatggccagtgtgttcccagccgatggaagtgtgatggagatcctgactgcgaagatggt
tcagatgaaagcccagaacagtgccatatgagaacatgccgcatacatgaaatcagctgt
ggcgcccattctactcagtgtatcccagtgtcctggagatgtgatggtgaaaatgattgt
gacagtggagaagatgaagaaaactgtggcaatataacatgtagtcccgacgagttcacc
tgctccagtggccgctgcatctccaggaactttgtatgcaatggccaggatgactgcagc
gatggcagtgatgagctggactgtgccccgccaacctgtggcgcccatgagttccagtgc
agcacctcctcctgcatccccatcagctgggtatgcgacgatgatgcagactgctccgac
caatctgatgagtccctggagcagtgtggccgtcagccagtcatacacaccaagtgtcca
gccagcgaaatccagtgcggctctggcgagtgcatccataagaagtggcgatgtgatggg
gaccctgactgcaaggatggcagtgatgaggtcaactgtccctctcgaacttgccgacct
gaccaatttgaatgtgaggatggcagctgcatccatggcagcaggcagtgtaatggtatc
cgagactgtgtcgatggttccgatgaagtcaactgcaaaaatgtcaatcagtgcttgggc
cctggaaaattcaagtgcagaagtggagaatgcatagatatcagcaaagtatgtaaccag
gagcaggactgcagggactggagtgatgagcccctgaaagagtgtcatataaacgaatgc
ttggtaaataatggtggatgttctcatatctgcaaagacctagttataggctacgagtgt
gactgtgcagctgggtttgaactgatagataggaaaacctgtggagatattgatgaatgc
caaaatccaggaatctgcagtcaaatttgtatcaacttaaaaggcggttacaagtgtgaa
tgtagtcgtggctatcaaatggatcttgctactggcgtgtgcaaggcagtaggcaaagag
ccaagtctgatcttcactaatcgaagagacatcaggaagattggcttagagaggaaagaa
tatatccaactagttgaacagctaagaaacactgtggctctcgatgctgacattgctgcc
cagaaactattctgggccgatctaagccaaaaggctatcttcagtgcctcaattgatgac
aaggttggtagacatgttaaaatgatcgacaatgtctataatcctgcagccattgctgtt
gattgggtgtacaagaccatctactggactgatgcggcttctaagactatttcagtagct
accctagatggaaccaagaggaagttcctgtttaactctgacttgcgagagcctgcctcc
atagctgtggacccactgtctggctttgtttactggtcagactggggtgaaccagctaaa
atagaaaaagcaggaatgaatggattcgatagacgtccactggtgacagcggatatccag
tggcctaacggaattacacttgaccttataaaaagtcgcctctattggcttgattctaag
ttgcacatgttatccagcgtggacttgaatggccaagatcgtaggatagtactaaagtct
ctggagttcctagctcatcctcttgcactaacaatatttgaggatcgtgtctactggata
gatggggaaaatgaagcagtctatggtgccaataaattcactggatcagagctagccact
ctagtcaacaacctgaatgatgcccaagacatcattgtctatcatgaacttgtacagcca
tcaggtaaaaattggtgtgaagaagacatggagaatggaggatgtgaatacctatgcctg
ccagcaccacagattaatgatcactctccaaaatatacctgttcctgtcccagtgggtac
aatgtagaggaaaatggccgagactgtcaaagtactgcaactactgtgacttacagtgag
acaaaagatacgaacacaacagaaatttcagcaactagtggactagttcctggagggatc
aatgtgaccacagcagtatcagaggtcagtgttcccccaaaagggacttctgccgcatgg
gccattcttcctctcttgctcttagtgatggcagcagtaggtggctacttgatgtggcgg
aattggcaacacaagaacatgaaaagcatgaactttgacaatcctgtgtacttgaaaacc
actgaagaggacctctccatagacattggtagacacagtgcttctgttggacacacgtac
ccagcaatatcagttgtaagcacagatgatgatctagcttga

DBGET integrated database retrieval system