KEGG   Homo sapiens (human): 7450Help
Entry
7450              CDS       T01001                                 

Gene name
VWF, F8VWF, VWD
Definition
(RefSeq) von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa05165  Human papillomavirus infection
Disease
H00219  Hemophilia
H01740  Macrothrombocytopenia
H02092  von Willebrand disease
Drug target
Fondaparinux: D11160
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7450 (VWF)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7450 (VWF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7450 (VWF)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    7450 (VWF)
   04611 Platelet activation
    7450 (VWF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7450 (VWF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7450 (VWF)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7450 (VWF)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   7450 (VWF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7450 (VWF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC VWA_3 Pacifastin_I MCR_beta_N
Motif
Other DBs
NCBI-GeneID: 7450
NCBI-ProteinID: NP_000543
OMIM: 613160
HGNC: 12726
Ensembl: ENSG00000110799
Vega: OTTHUMG00000168265
Pharos: P04275(Tbio)
UniProt: P04275
LinkDB All DBs
Structure
PDB: 

Position
12p13.31
AA seq 2813 aa AA seqDB search
MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL
LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG
TSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDVQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ
CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE
TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY
LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY
ECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE
VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVE
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE
YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI
TLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL
SSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVA
FVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGD
ILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLP
GDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL
SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITT
IDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV
TDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTM
VTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD
RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNK
EQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEV
NVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD
GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFY
AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC
DGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQI
CTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHC
ERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN
STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAV
MGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ
WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERME
ACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC
CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHK
CLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMY
SIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
NT seq 8442 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgccagatttgccggggtgctgcttgctctggccctcattttgccagggacc
ctttgtgcagaaggaactcgcggcaggtcatccacggcccgatgcagccttttcggaagt
gacttcgtcaacacctttgatgggagcatgtacagctttgcgggatactgcagttacctc
ctggcagggggctgccagaaacgctccttctcgattattggggacttccagaatggcaag
agagtgagcctctccgtgtatcttggggaattttttgacatccatttgtttgtcaatggt
accgtgacacagggggaccaaagagtctccatgccctatgcctccaaagggctgtatcta
gaaactgaggctgggtactacaagctgtccggtgaggcctatggctttgtggccaggatc
gatggcagcggcaactttcaagtcctgctgtcagacagatacttcaacaagacctgcggg
ctgtgtggcaactttaacatctttgctgaagatgactttatgacccaagaagggaccttg
acctcggacccttatgactttgccaactcatgggctctgagcagtggagaacagtggtgt
gaacgggcatctcctcccagcagctcatgcaacatctcctctggggaaatgcagaagggc
ctgtgggagcagtgccagcttctgaagagcacctcggtgtttgcccgctgccaccctctg
gtggaccccgagccttttgtggccctgtgtgagaagactttgtgtgagtgtgctgggggg
ctggagtgcgcctgccctgccctcctggagtacgcccggacctgtgcccaggagggaatg
gtgctgtacggctggaccgaccacagcgcgtgcagcccagtgtgccctgctggtatggag
tataggcagtgtgtgtccccttgcgccaggacctgccagagcctgcacatcaatgaaatg
tgtcaggagcgatgcgtggatggctgcagctgccctgagggacagctcctggatgaaggc
ctctgcgtggagagcaccgagtgtccctgcgtgcattccggaaagcgctaccctcccggc
acctccctctctcgagactgcaacacctgcatttgccgaaacagccagtggatctgcagc
aatgaagaatgtccaggggagtgccttgtcacaggtcaatcacacttcaagagctttgac
aacagatacttcaccttcagtgggatctgccagtacctgctggcccgggattgccaggac
cactccttctccattgtcattgagactgtccagtgtgctgatgaccgcgacgctgtgtgc
acccgctccgtcaccgtccggctgcctggcctgcacaacagccttgtgaaactgaagcat
ggggcaggagttgccatggatggccaggacgtccagctccccctcctgaaaggtgacctc
cgcatccagcatacagtgacggcctccgtgcgcctcagctacggggaggacctgcagatg
gactgggatggccgcgggaggctgctggtgaagctgtcccccgtctatgccgggaagacc
tgcggcctgtgtgggaattacaatggcaaccagggcgacgacttccttaccccctctggg
ctggcggagccccgggtggaggacttcgggaacgcctggaagctgcacggggactgccag
gacctgcagaagcagcacagcgatccctgcgccctcaacccgcgcatgaccaggttctcc
gaggaggcgtgcgcggtcctgacgtcccccacattcgaggcctgccatcgtgccgtcagc
ccgctgccctacctgcggaactgccgctacgacgtgtgctcctgctcggacggccgcgag
tgcctgtgcggcgccctggccagctatgccgcggcctgcgcggggagaggcgtgcgcgtc
gcgtggcgcgagccaggccgctgtgagctgaactgcccgaaaggccaggtgtacctgcag
tgcgggaccccctgcaacctgacctgccgctctctctcttacccggatgaggaatgcaat
gaggcctgcctggagggctgcttctgccccccagggctctacatggatgagaggggggac
tgcgtgcccaaggcccagtgcccctgttactatgacggtgagatcttccagccagaagac
atcttctcagaccatcacaccatgtgctactgtgaggatggcttcatgcactgtaccatg
agtggagtccccggaagcttgctgcctgacgctgtcctcagcagtcccctgtctcatcgc
agcaaaaggagcctatcctgtcggccccccatggtcaagctggtgtgtcccgctgacaac
ctgcgggctgaagggctcgagtgtaccaaaacgtgccagaactatgacctggagtgcatg
agcatgggctgtgtctctggctgcctctgccccccgggcatggtccggcatgagaacaga
tgtgtggccctggaaaggtgtccctgcttccatcagggcaaggagtatgcccctggagaa
acagtgaagattggctgcaacacttgtgtctgtcgggaccggaagtggaactgcacagac
catgtgtgtgatgccacgtgctccacgatcggcatggcccactacctcaccttcgacggg
ctcaaatacctgttccccggggagtgccagtacgttctggtgcaggattactgcggcagt
aaccctgggacctttcggatcctagtggggaataagggatgcagccacccctcagtgaaa
tgcaagaaacgggtcaccatcctggtggagggaggagagattgagctgtttgacggggag
gtgaatgtgaagaggcccatgaaggatgagactcactttgaggtggtggagtctggccgg
tacatcattctgctgctgggcaaagccctctccgtggtctgggaccgccacctgagcatc
tccgtggtcctgaagcagacataccaggagaaagtgtgtggcctgtgtgggaattttgat
ggcatccagaacaatgacctcaccagcagcaacctccaagtggaggaagaccctgtggac
tttgggaactcctggaaagtgagctcgcagtgtgctgacaccagaaaagtgcctctggac
tcatcccctgccacctgccataacaacatcatgaagcagacgatggtggattcctcctgt
agaatccttaccagtgacgtcttccaggactgcaacaagctggtggaccccgagccatat
ctggatgtctgcatttacgacacctgctcctgtgagtccattggggactgcgcctgcttc
tgcgacaccattgctgcctatgcccacgtgtgtgcccagcatggcaaggtggtgacctgg
aggacggccacattgtgcccccagagctgcgaggagaggaatctccgggagaacgggtat
gagtgtgagtggcgctataacagctgtgcacctgcctgtcaagtcacgtgtcagcaccct
gagccactggcctgccctgtgcagtgtgtggagggctgccatgcccactgccctccaggg
aaaatcctggatgagcttttgcagacctgcgttgaccctgaagactgtccagtgtgtgag
gtggctggccggcgttttgcctcaggaaagaaagtcaccttgaatcccagtgaccctgag
cactgccagatttgccactgtgatgttgtcaacctcacctgtgaagcctgccaggagccg
ggaggcctggtggtgcctcccacagatgccccggtgagccccaccactctgtatgtggag
gacatctcggaaccgccgttgcacgatttctactgcagcaggctactggacctggtcttc
ctgctggatggctcctccaggctgtccgaggctgagtttgaagtgctgaaggcctttgtg
gtggacatgatggagcggctgcgcatctcccagaagtgggtccgcgtggccgtggtggag
taccacgacggctcccacgcctacatcgggctcaaggaccggaagcgaccgtcagagctg
cggcgcattgccagccaggtgaagtatgcgggcagccaggtggcctccaccagcgaggtc
ttgaaatacacactgttccaaatcttcagcaagatcgaccgccctgaagcctcccgcatc
accctgctcctgatggccagccaggagccccaacggatgtcccggaactttgtccgctac
gtccagggcctgaagaagaagaaggtcattgtgatcccggtgggcattgggccccatgcc
aacctcaagcagatccgcctcatcgagaagcaggcccctgagaacaaggccttcgtgctg
agcagtgtggatgagctggagcagcaaagggacgagatcgttagctacctctgtgacctt
gcccctgaagcccctcctcctactctgccccccgacatggcacaagtcactgtgggcccg
gggctcttgggggtttcgaccctggggcccaagaggaactccatggttctggatgtggcg
ttcgtcctggaaggatcggacaaaattggtgaagccgacttcaacaggagcaaggagttc
atggaggaggtgattcagcggatggatgtgggccaggacagcatccacgtcacggtgctg
cagtactcctacatggtgactgtggagtaccccttcagcgaggcacagtccaaaggggac
atcctgcagcgggtgcgagagatccgctaccagggcggcaacaggaccaacactgggctg
gccctgcggtacctctctgaccacagcttcttggtcagccagggtgaccgggagcaggcg
cccaacctggtctacatggtcaccggaaatcctgcctctgatgagatcaagaggctgcct
ggagacatccaggtggtgcccattggagtgggccctaatgccaacgtgcaggagctggag
aggattggctggcccaatgcccctatcctcatccaggactttgagacgctcccccgagag
gctcctgacctggtgctgcagaggtgctgctccggagaggggctgcagatccccaccctc
tcccctgcacctgactgcagccagcccctggacgtgatccttctcctggatggctcctcc
agtttcccagcttcttattttgatgaaatgaagagtttcgccaaggctttcatttcaaaa
gccaatatagggcctcgtctcactcaggtgtcagtgctgcagtatggaagcatcaccacc
attgacgtgccatggaacgtggtcccggagaaagcccatttgctgagccttgtggacgtc
atgcagcgggagggaggccccagccaaatcggggatgccttgggctttgctgtgcgatac
ttgacttcagaaatgcatggtgccaggccgggagcctcaaaggcggtggtcatcctggtc
acggacgtctctgtggattcagtggatgcagcagctgatgccgccaggtccaacagagtg
acagtgttccctattggaattggagatcgctacgatgcagcccagctacggatcttggca
ggcccagcaggcgactccaacgtggtgaagctccagcgaatcgaagacctccctaccatg
gtcaccttgggcaattccttcctccacaaactgtgctctggatttgttaggatttgcatg
gatgaggatgggaatgagaagaggcccggggacgtctggaccttgccagaccagtgccac
accgtgacttgccagccagatggccagaccttgctgaagagtcatcgggtcaactgtgac
cgggggctgaggccttcgtgccctaacagccagtcccctgttaaagtggaagagacctgt
ggctgccgctggacctgcccctgcgtgtgcacaggcagctccactcggcacatcgtgacc
tttgatgggcagaatttcaagctgactggcagctgttcttatgtcctatttcaaaacaag
gagcaggacctggaggtgattctccataatggtgcctgcagccctggagcaaggcagggc
tgcatgaaatccatcgaggtgaagcacagtgccctctccgtcgagctgcacagtgacatg
gaggtgacggtgaatgggagactggtctctgttccttacgtgggtgggaacatggaagtc
aacgtttatggtgccatcatgcatgaggtcagattcaatcaccttggtcacatcttcaca
ttcactccacaaaacaatgagttccaactgcagctcagccccaagacttttgcttcaaag
acgtatggtctgtgtgggatctgtgatgagaacggagccaatgacttcatgctgagggat
ggcacagtcaccacagactggaaaacacttgttcaggaatggactgtgcagcggccaggg
cagacgtgccagcccatcctggaggagcagtgtcttgtccccgacagctcccactgccag
gtcctcctcttaccactgtttgctgaatgccacaaggtcctggctccagccacattctat
gccatctgccagcaggacagttgccaccaggagcaagtgtgtgaggtgatcgcctcttat
gcccacctctgtcggaccaacggggtctgcgttgactggaggacacctgatttctgtgct
atgtcatgcccaccatctctggtctacaaccactgtgagcatggctgtccccggcactgt
gatggcaacgtgagctcctgtggggaccatccctccgaaggctgtttctgccctccagat
aaagtcatgttggaaggcagctgtgtccctgaagaggcctgcactcagtgcattggtgag
gatggagtccagcaccagttcctggaagcctgggtcccggaccaccagccctgtcagatc
tgcacatgcctcagcgggcggaaggtcaactgcacaacgcagccctgccccacggccaaa
gctcccacgtgtggcctgtgtgaagtagcccgcctccgccagaatgcagaccagtgctgc
cccgagtatgagtgtgtgtgtgacccagtgagctgtgacctgcccccagtgcctcactgt
gaacgtggcctccagcccacactgaccaaccctggcgagtgcagacccaacttcacctgc
gcctgcaggaaggaggagtgcaaaagagtgtccccaccctcctgccccccgcaccgtttg
cccacccttcggaagacccagtgctgtgatgagtatgagtgtgcctgcaactgtgtcaac
tccacagtgagctgtccccttgggtacttggcctcaactgccaccaatgactgtggctgt
accacaaccacctgccttcccgacaaggtgtgtgtccaccgaagcaccatctaccctgtg
ggccagttctgggaggagggctgcgatgtgtgcacctgcaccgacatggaggatgccgtg
atgggcctccgcgtggcccagtgctcccagaagccctgtgaggacagctgtcggtcgggc
ttcacttacgttctgcatgaaggcgagtgctgtggaaggtgcctgccatctgcctgtgag
gtggtgactggctcaccgcggggggactcccagtcttcctggaagagtgtcggctcccag
tgggcctccccggagaacccctgcctcatcaatgagtgtgtccgagtgaaggaggaggtc
tttatacaacaaaggaacgtctcctgcccccagctggaggtccctgtctgcccctcgggc
tttcagctgagctgtaagacctcagcgtgctgcccaagctgtcgctgtgagcgcatggag
gcctgcatgctcaatggcactgtcattgggcccgggaagactgtgatgatcgatgtgtgc
acgacctgccgctgcatggtgcaggtgggggtcatctctggattcaagctggagtgcagg
aagaccacctgcaacccctgccccctgggttacaaggaagaaaataacacaggtgaatgt
tgtgggagatgtttgcctacggcttgcaccattcagctaagaggaggacagatcatgaca
ctgaagcgtgatgagacgctccaggatggctgtgatactcacttctgcaaggtcaatgag
agaggagagtacttctgggagaagagggtcacaggctgcccaccctttgatgaacacaag
tgtctggctgagggaggtaaaattatgaaaattccaggcacctgctgtgacacatgtgag
gagcctgagtgcaacgacatcactgccaggctgcagtatgtcaaggtgggaagctgtaag
tctgaagtagaggtggatatccactactgccagggcaaatgtgccagcaaagccatgtac
tccattgacatcaacgatgtgcaggaccagtgctcctgctgctctccgacacggacggag
cccatgcaggtggccctgcactgcaccaatggctctgttgtgtaccatgaggttctcaat
gccatggagtgcaaatgctcccccaggaagtgcagcaagtga

DBGET integrated database retrieval system