KEGG   Homo sapiens (human): 7474Help
Entry
7474              CDS       T01001                                 

Gene name
WNT5A, hWNT5A
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00485  Robinow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7474 (WNT5A)
   04390 Hippo signaling pathway
    7474 (WNT5A)
   04150 mTOR signaling pathway
    7474 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7474 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7474 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    7474 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7474 (WNT5A)
   05205 Proteoglycans in cancer
    7474 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7474 (WNT5A)
   05226 Gastric cancer
    7474 (WNT5A)
   05217 Basal cell carcinoma
    7474 (WNT5A)
   05224 Breast cancer
    7474 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7474 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7474 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7474 (WNT5A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Morphogens
   7474 (WNT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7474
NCBI-ProteinID: NP_003383
OMIM: 164975
HGNC: 12784
Ensembl: ENSG00000114251
Vega: OTTHUMG00000158361
Pharos: P41221(Tbio)
UniProt: P41221 A0A384N611 B3KQX9
LinkDB All DBs
Position
3p14.3
AA seq 380 aa AA seqDB search
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctagtggctttggccatatttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcagacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtacaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccccagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgtggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Homo sapiens (human): 81029Help
Entry
81029             CDS       T01001                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    81029 (WNT5B)
   04390 Hippo signaling pathway
    81029 (WNT5B)
   04150 mTOR signaling pathway
    81029 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81029 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    81029 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    81029 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81029 (WNT5B)
   05205 Proteoglycans in cancer
    81029 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81029 (WNT5B)
   05226 Gastric cancer
    81029 (WNT5B)
   05217 Basal cell carcinoma
    81029 (WNT5B)
   05224 Breast cancer
    81029 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81029 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81029 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    81029 (WNT5B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Morphogens
   81029 (WNT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 81029
NCBI-ProteinID: NP_110402
OMIM: 606361
HGNC: 16265
Ensembl: ENSG00000111186
Vega: OTTHUMG00000090375
Pharos: Q9H1J7(Tbio)
UniProt: Q9H1J7
LinkDB All DBs
Position
12p13.33
AA seq 359 aa AA seqDB search
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaattgcagcacagcggacaacgca
tctgtctttgggagagtcatgcagataggcagccgagagaccgccttcacccacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagcgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctat
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaggtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

DBGET integrated database retrieval system