KEGG   Homo sapiens (human): 7481Help
Entry
7481              CDS       T01001                                 

Gene name
WNT11, HWNT11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7481 (WNT11)
   04390 Hippo signaling pathway
    7481 (WNT11)
   04150 mTOR signaling pathway
    7481 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7481 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7481 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7481 (WNT11)
   05205 Proteoglycans in cancer
    7481 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7481 (WNT11)
   05226 Gastric cancer
    7481 (WNT11)
   05217 Basal cell carcinoma
    7481 (WNT11)
   05224 Breast cancer
    7481 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7481 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7481 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7481 (WNT11)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Morphogens
   7481 (WNT11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7481
NCBI-ProteinID: NP_004617
OMIM: 603699
HGNC: 12776
Ensembl: ENSG00000085741
Vega: OTTHUMG00000165264
Pharos: O96014(Tbio)
UniProt: O96014
LinkDB All DBs
Position
11q13.5
AA seq 354 aa AA seqDB search
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacaccatcggccctggcactgaac
cagacgcaacactgcaagcagctggagggtctggtgtctgcacaggtgcagctgtgccgc
agcaacctggagctcatgcacacggtggtgcacgccgcccgcgaggtcatgaaggcctgt
cgccgggcctttgccgacatgcgctggaactgctcctccattgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagctgcaggatgtggctgctgacctcaagacccga
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggatatccggcctgtgaaggactcggaactcgtctatctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccacgggacacaagacaggcagtgcaac
aagacatccaacggaagcgacagctgcgaccttatgtgctgcgggcgtggctacaacccc
tacacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctacgtcacc
tgccgcaggtgtgagcgtaccgtggagcgctatgtctgcaagtga

DBGET integrated database retrieval system