KEGG   Homo sapiens (human): 7507
Entry
7507              CDS       T01001                                 

Gene name
XPA, XP1, XPAC
Definition
(RefSeq) XPA, DNA damage recognition and repair factor
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03420  Nucleotide excision repair
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    7507 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    7507 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7507 (XPA)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     7507 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N Zn-ribbon_8 zf_C2H2_13 Ion_trans_N
Other DBs
NCBI-GeneID: 7507
NCBI-ProteinID: NP_000371
OMIM: 611153
HGNC: 12814
Ensembl: ENSG00000136936
Vega: OTTHUMG00000020330
Pharos: P23025(Tbio)
UniProt: P23025
LinkDB
Structure
PDB: 
6J44 6RO4 1D4U 1XPA

Position
9q22.33
AA seq 273 aa
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggggctttgccggaggcggcggctttagagcaacccgcggagctg
cctgcctcggtgcgggcgagtatcgagcggaagcggcagcgggcactgatgctgcgccag
gcccggctggctgcccggccctactcggcgacggcggctgcggctactggaggcatggct
aatgtaaaagcagccccaaagataattgacacaggaggaggcttcattttagaagaggaa
gaagaagaagaacagaaaattggaaaagttgttcatcaaccaggacctgttatggaattt
gattatgtaatatgcgaagaatgtgggaaagaatttatggattcttatcttatgaaccac
tttgatttgccaacttgtgataactgcagagatgctgatgataaacacaagcttataacc
aaaacagaggcaaaacaagaatatcttctgaaagactgtgatttagaaaaaagagagcca
cctcttaaatttattgtgaagaagaatccacatcattcacaatggggtgatatgaaactc
tacttaaagttacagattgtgaagaggtctcttgaagtttggggtagtcaagaagcatta
gaagaagcaaaggaagtccgacaggaaaaccgagaaaaaatgaaacagaagaaatttgat
aaaaaagtaaaagaattgcggcgagcagtaagaagcagcgtgtggaaaagggagacgatt
gttcatcaacatgagtatggaccagaagaaaacctagaagatgacatgtaccgtaagact
tgtactatgtgtggccatgaactgacatatgaaaaaatgtga

DBGET integrated database retrieval system