KEGG   Homo sapiens (human): 7538Help
Entry
7538              CDS       T01001                                 

Gene name
ZFP36, G0S24, GOS24, NUP475, RNF162A, TIS11, TTP, zfp-36
Definition
(RefSeq) ZFP36 ring finger protein
  KO
K15308  tristetraprolin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06110  MAPK signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7538 (ZFP36)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7538 (ZFP36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7538 (ZFP36)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     7538 (ZFP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 7538
NCBI-ProteinID: NP_003398
OMIM: 190700
HGNC: 12862
Ensembl: ENSG00000128016
Vega: OTTHUMG00000182970
Pharos: P26651(Tbio)
UniProt: P26651 M0QY76
LinkDB All DBs
Position
19q13.2
AA seq 326 aa AA seqDB search
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
GAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
AGVFAPPQPVAAPRRLPIFNRISVSE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggatctgactgccatctacgagagcctcctgtcgctgagccctgacgtgcccgtgcca
tccgaccatggagggactgagtccagcccaggctggggctcctcgggaccctggagcctg
agcccctccgactccagcccgtctggggtcacctcccgcctgcctggccgctccaccagc
ctagtggagggccgcagctgtggctgggtgcccccaccccctggcttcgcaccgctggct
ccccgcctgggccctgagctgtcaccctcacccacttcgcccactgcaacctccaccacc
ccctcgcgctacaagactgagctatgtcggaccttctcagagagtgggcgctgccgctac
ggggccaagtgccagtttgcccatggcctgggcgagctgcgccaggccaatcgccacccc
aaatacaagacggaactctgtcacaagttctacctccagggccgctgcccctacggctct
cgctgccacttcatccacaaccctagcgaagacctggcggccccgggccaccctcctgtg
cttcgccagagcatcagcttctccggcctgccctctggccgccggacctcaccaccacca
ccaggcctggccggcccttccctgtcctccagctccttctcgccctccagctccccacca
ccacctggggaccttccactgtcaccctctgccttctctgctgcccctggcacccccctg
gctcgaagagaccccaccccagtctgttgcccctcctgccgaagggccactcctatcagc
gtctgggggcccttgggtggcctggttcggaccccctctgtacagtccctgggatccgac
cctgatgaatatgccagcagcggcagcagcctggggggctctgactctcccgtcttcgag
gcgggagtttttgcaccaccccagcccgtggcagccccccggcgactccccatcttcaat
cgcatctctgtttctgagtga

DBGET integrated database retrieval system