KEGG   Homo sapiens (human): 7709Help
Entry
7709              CDS       T01001                                 

Gene name
ZBTB17, MIZ-1, ZNF151, ZNF60, pHZ-67
Definition
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06267  Small cell lung cancer
  Element
N00090  p15-Cell cycle G1/S
N00132  Amplified MYCN to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7709 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7709 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    7709 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7709 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7709 (ZBTB17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     7709 (ZBTB17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_11 zf-C2H2_jaz zf-met zf-C2H2_6 Zn-ribbon_8 zf-H2C2_5 zf_UBZ zinc_ribbon_15 zf-Di19 zf-C2HE Packaging_FI XPA_N zf-C2HC_2 zf-BED DUF3268
Motif
Other DBs
NCBI-GeneID: 7709
NCBI-ProteinID: NP_003434
OMIM: 604084
HGNC: 12936
Ensembl: ENSG00000116809
Vega: OTTHUMG00000009377
Pharos: Q13105(Tbio)
UniProt: Q13105
LinkDB All DBs
Structure
PDB: 

Position
1p36.13
AA seq 803 aa AA seqDB search
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggactttccccagcacagccagcatgtcttggaacagctgaaccagcagcggcagctg
gggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaaggacgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggcc
aagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccactttcctccaa
atgcaggacatcatcacggcctgccatgccctcaagtcacttgctgagccggctaccagc
cctgggggaaatgcggaggccttggccacagaaggaggggacaagagagccaaagaggag
aaggtggccaccagcacgctgagcaggctggagcaggcaggacgcagcacacccataggc
cccagcagggacctcaaggaggagcgcggcggtcaggcccagagtgcggccagcggtgca
gagcagacagagaaagccgatgcgccccgggagccgccgcctgtggagctcaagccagac
cccacgagtggcatggctgctgcagaagctgaggccgctttgtccgagagctcggagcaa
gaaatggaggtggagcccgcccggaaaggggaagaggagcaaaaggagcaagaggagcaa
gaggaggagggcgcagggccagctgaggtcaaggaggagggttcccagctggagaacgga
gaggcccccgaggagaacgagaatgaggagtcagcgggcacagactcggggcaggagctc
ggctccgaggcccggggcctgcgctcaggcacctacggcgaccgcacggagtccaaggcc
tacggctccgtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaac
ttcaagcggcacatccgcatccacacgggggagaagcccttctcgtgccgggagtgcagc
aaggccttttccgacccggccgcgtgcaaggcccatgagaagacgcacagccctctgaag
ccctacggctgcgaggagtgcgggaagagctaccgcctcatcagcctgctgaacctgcac
aagaagcggcactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcacc
acctcgggcaacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgc
gactactgcggccgctccttctccgaccccacttccaagatgcgccacctggagacccac
gacacggacaaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaac
ctgaaggcccacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtggg
aagcagttcaccacctcagggaacctgaagcggcaccttcggatccacagcggggagaag
ccctacgtgtgcatccactgccagcgacagtttgcagaccccggcgctctgcagcggcac
gtccgcattcacacaggtgagaagccatgccagtgtgtgatgtgcggtaaggccttcacc
caggccagctccctcatcgcccacgtgcgccagcacaccggggagaagccctacgtctgc
gagcgctgcggcaagagattcgtccagtccagccagttggccaatcatattcgccaccac
gacaacatccgcccacacaagtgcagcgtgtgcagcaaggccttcgtgaacgtgggggac
ctgtccaagcacatcatcattcacactggagagaagccttacctgtgtgataagtgtggg
cgtggcttcaaccgggtagacaacctgcgctcccacgtgaagaccgtgcaccagggcaag
gcaggcatcaagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggat
gacatggtcacgctggctaccgaggcactggcagcgacagccgtcactcagctcacagtg
gtgccggtgggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagc
aaagctgtgaagcaagtgcaggaagaagaccccaacactcacatcctctacgcctgtgac
tcctgtggggacaagtttctggatgccaacagcctggctcagcatgtgcgaatccacaca
gcccaggcactggtcatgttccagacagacgcggacttctatcagcagtatgggccaggt
ggcacgtggcctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgcgac
ggggctgagggccagcccgcactggcagagacctcccctacagctcctgaatgtcccccg
cctgccgagtga

DBGET integrated database retrieval system